(data stored in SCRATCH zone)

EMBL: CP002399.PE595

CP002399.PE595       Location/Qualifiers
FT   CDS_pept        complement(617570..618898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0599"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="KEGG: stp:Strop_3903 preprotein translocase subunit
FT                   SecY; TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06149"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADU06149.1"
FT                   /translation="MLSAFLSAFRTPDLRKKLLFTVGIIAVYRLGATLPSPGVSYGNVQ
FT                   KCLDTIQGGSTGVLNLLDLFSGGALLQLSVFALGIMPYITASIILQLLTVVIPRLEQLR
FT                   KEGQAGQAKITQYTRYLTLGLGVLQASAFVALARSGQLFNNQCDQFPIVPEGTGIPNWL
FT                   TLSILVMTMTAGTGVVMWLGELITDRGVGNGMSVLIFTSIAARLPSEGWKIKTTKGWGM
FT                   FLLVIALVLVVITAVTFIEQAQRRIPVQYAKRMIGRRMYGGTSTYIPLKVNQAGVIPVI
FT                   FASSLLYLPQLALQFFDQNDPGKVQAWIQNHIVKASAPEHIAIYFLLIIFFTYFYVSIT
FT                   FNPTEVADNMKKYGGFVPGIRPGKPTAEYLDFILSRITLPGALYLGIVAILPNFFFIWL
FT                   DNQQFQNFPFGGTAVLIMVGVGLETVKQIESQLMQRNYEGFLR"
     ttgctgtccg cctttctcag tgcgttccgt acgcctgacc tgcgcaagaa gctgctgttc        60
     acagtaggca tcatcgcggt ctaccggctg ggcgccacgc tgcccagccc gggcgtctcg       120
     tacggcaacg tgcagaagtg cctcgacacg atccagggtg gcagcacggg tgtgctgaac       180
     ctgctggatc tcttctccgg tggtgcgctg ctccagctct cggtcttcgc gctgggcatc       240
     atgccctaca tcaccgcgtc gatcatcctt cagctgctga cggtggtgat cccgcgtctg       300
     gagcagctcc gcaaggaggg ccaggccggg caggccaaga tcacgcagta cacccgctac       360
     ctgacgctgg gcctgggtgt cctccaggcc tcggcgttcg tggcgctggc ccgctccggg       420
     cagctgttca acaaccagtg cgaccagttc ccgatcgtgc ccgagggcac cggcatcccg       480
     aactggctga ccctgagcat cctggtcatg accatgaccg ccggcaccgg cgtggtgatg       540
     tggctcggtg agctgatcac cgaccggggc gtcggcaacg gcatgtccgt gctgatcttc       600
     acctcgatcg cggcccgcct ccccagcgag ggctggaaga tcaagaccac caagggctgg       660
     gggatgttcc tcctcgtcat cgccctggtg ctggtggtca tcaccgctgt cacgttcatc       720
     gagcaggcgc agcgccgcat cccggtgcag tacgccaagc gcatgatcgg ccggcggatg       780
     tacggcggca cgtcgaccta catcccgctg aaggtgaacc aggcgggcgt catcccggtc       840
     atcttcgcct cgtcgctgct ctacctgccg cagctcgcgc tccagttctt cgatcagaac       900
     gacccgggca aggtccaggc gtggatccag aaccacatcg tgaaggcgag cgcgccggag       960
     cacatcgcga tctacttcct gctgatcatc ttcttcacgt acttctacgt gtcgatcacg      1020
     ttcaacccga ccgaggtcgc ggacaacatg aagaagtacg gcggcttcgt gccgggcatc      1080
     cgccccggca agccgaccgc cgagtacctc gacttcatcc tcagccggat caccctgccg      1140
     ggcgcgctct acctgggcat cgtcgcgatc ctgccgaact tcttcttcat ctggctcgac      1200
     aaccagcagt tccagaactt cccgttcggc ggcaccgctg tgctcatcat ggtcggcgtc      1260
     ggtctggaga ccgtgaagca gatcgagagc caactcatgc agcggaacta cgaagggttc      1320
     ctgcggtag                                                              1329
//

If you have problems or comments...

PBIL Back to PBIL home page