(data stored in SCRATCH zone)

EMBL: CP002399.PE611

CP002399.PE611       Location/Qualifiers
FT   CDS_pept        complement(625715..625996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0615"
FT                   /product="ribosomal protein S19"
FT                   /note="KEGG: saq:Sare_4311 30S ribosomal protein S19;
FT                   TIGRFAM: ribosomal protein S19; PFAM: ribosomal protein
FT                   S19/S15"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06165"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADU06165.1"
FT                   /translation="MPRSLKKGPFVDDHLLKKVETQNDKGSKNVIKTWSRRSTIIPEML
FT                   GHTIAVHDGRKHVPVFVTEAMVGHKLGEFALTRTFKGHEKDDRKSRRR"
     atgcctcgca gcctgaagaa gggcccgttc gtcgacgacc acctgctcaa gaaggtggag        60
     acgcagaacg acaagggctc gaagaacgtg atcaagacct ggtcgcggcg ctcgacgatc       120
     atcccggaga tgctgggtca cacgatcgcc gtgcacgacg gacgcaagca cgtcccggtc       180
     ttcgtgaccg aggccatggt cgggcacaag ctcggcgagt tcgcgctgac ccgcacgttc       240
     aagggtcacg agaaggacga ccggaagagc cgccggcgct ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page