(data stored in SCRATCH zone)

EMBL: CP002399.PE612

CP002399.PE612       Location/Qualifiers
FT   CDS_pept        complement(626009..626848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0616"
FT                   /product="ribosomal protein L2"
FT                   /note="KEGG: saq:Sare_4312 50S ribosomal protein L2;
FT                   TIGRFAM: ribosomal protein L2; PFAM: ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06166"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADU06166.1"
FT                   /translation="MAIRKYKPTTPGRRGSSVADFAEITRSTPEKSLLAPLPKKGGRNA
FT                   HGRITTRHHGGGHKRQYRLIDFKRVDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRY
FT                   IIAPKDLKQGDRVESGPGADIKPGNNLPLRNIPVGTTIHNVELRPGGGAKLARSAGVGI
FT                   QLLGREGAYATLRMPSGEIRRVDVRCRASIGEIGNADQSNINWGKAGRMRWKGKRPTVR
FT                   GVAMNPVDHPHGGGEGKTSGGRHPVNPQGKPEGRTRRKGQPSDRLIVRRRYATRKRG"
     atggctatcc gtaagtacaa gccgacgacg ccgggccggc gtggctcgag cgttgccgac        60
     ttcgccgaga tcacccggtc gacgcccgag aagtcgctgc tggctccgct gccgaagaag       120
     ggcggacgca acgcccacgg ccggatcacc acgcggcacc acggtggcgg ccacaagcgc       180
     cagtaccgtc tgatcgactt caagcgggtc gacaaggacg gcgtgccggc gaaggtcgcc       240
     cacatcgagt acgacccgaa ccgcaccgcg cgcatcgcgc tgctgcacta cgccgacggc       300
     gagaagcgtt acatcatcgc gccgaaggac ctgaagcagg gcgaccgtgt cgagtccggt       360
     ccgggcgccg acatcaagcc gggcaacaac ctgccgctgc gcaacatccc ggtcggtacc       420
     accatccaca acgtggagct gcgtccgggc ggcggcgcca agctggcccg ctcggccggc       480
     gtcggcatcc agctgctcgg ccgtgagggc gcgtacgcga ccctgcgtat gccgtccggt       540
     gagatccggc gcgtggacgt gcgctgccgc gccagcatcg gcgagatcgg caacgccgac       600
     cagtcgaaca tcaactgggg taaggccggc cgtatgcggt ggaagggcaa gcgcccgacc       660
     gtccgtggtg tcgcgatgaa cccggtcgac cacccgcacg gtggtggtga gggtaagacc       720
     tccggtggtc gccacccggt caacccgcag ggtaagcccg agggccgcac ccgtcgtaag       780
     ggccagccga gcgaccggct gatcgtccgc cgccgctacg ccacgcgtaa gcgcggctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page