(data stored in SCRATCH zone)

EMBL: CP002399.PE613

CP002399.PE613       Location/Qualifiers
FT   CDS_pept        complement(626861..627163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0617"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: saq:Sare_4313
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06167"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADU06167.1"
FT                   /translation="MSTIADPRDVIVAPVVSEKSYSELNRNWYTFLVHPDANKTEIKIA
FT                   IQQIFNVRVLTVNTLNREGKRKRTRTGFGKRKDTKRAMVKLADGDRIEAFGGPVS"
     gtgagcacga tcgccgatcc gcgtgacgtc atcgtcgcgc cggtcgtctc ggagaagagc        60
     tacagcgagc tgaaccgcaa ctggtacacc ttcctggtgc acccggacgc caacaagacg       120
     gagatcaaga tcgctatcca gcagatcttc aacgtccgcg tcctgacggt caacacgctc       180
     aaccgcgagg gcaagcgcaa gcggacccgt accgggttcg gcaagcgcaa ggacaccaag       240
     cgcgcgatgg tgaagctggc tgacggtgac cgtatcgagg ccttcggcgg cccggtcagc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page