(data stored in SCRATCH zone)

EMBL: CP002399.PE616

CP002399.PE616       Location/Qualifiers
FT   CDS_pept        complement(628499..628807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0620"
FT                   /product="ribosomal protein S10"
FT                   /note="KEGG: saq:Sare_4316 30S ribosomal protein S10;
FT                   TIGRFAM: ribosomal protein S10; PFAM: ribosomal protein
FT                   S10"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06170"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADU06170.1"
FT                   /translation="MAGQKIRIRLKAYDHEVVDSSARKIVETVTRTGAQVAGPVPLPTE
FT                   INRFCVIRSPHKYKDSREHFEMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDIEIKL"
     atggcgggac agaagatccg catccggctc aaggcctatg accacgaggt cgtcgactcc        60
     tcggctcgga agatcgtcga gacggtgacg cgtaccgggg cgcaggtcgc tggcccggtg       120
     ccgctgccca cggagatcaa ccgtttctgc gtcatccgct cgccgcacaa gtacaaggac       180
     tcgcgcgagc acttcgagat gcgtacgcac aagcgtctga tcgacatcat cgacccgacc       240
     ccgaagacgg tcgactcgct catgcgcctc gacctgccgg ctggcgtcga catcgagatc       300
     aagctgtag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page