(data stored in SCRATCH zone)

EMBL: CP002399.PE621

CP002399.PE621       Location/Qualifiers
FT   CDS_pept        complement(634099..634716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0625"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_3929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06175"
FT                   /inference="similar to AA sequence:KEGG:Strop_3929"
FT                   /protein_id="ADU06175.1"
FT                   /translation="MTEPAPPGGDQPRPGPYPPGSASAPAHQPGPYGAYPGSPPAHGGG
FT                   WPAPASVPGHGGWGPHGGPALPPPPAETPRPPKRVDAVPGTPFGVVHLDVPPVTSGLAI
FT                   GSLVAGIAAIGVSLLVLCFGLAGRDVGGAWAAGAFTVLGGLIGAGAVVAGLLARRQIRR
FT                   PAPPPSVRFTGAGLAVAGISCGAAGVLFGLIGLALALVVQIT"
     gtgacggaac cggctccgcc gggaggcgac cagccgcgcc ccgggccgta cccgccgggt        60
     tccgcgtccg cgccggcgca ccagccgggg ccgtacgggg cgtacccggg gagtccgccg       120
     gcgcacggcg gcgggtggcc ggcgccggcg agcgtgcccg gccacggcgg ctggggtccg       180
     cacggcgggc cggcgcttcc gccgccgccg gccgagacgc cgcggccgcc gaagcgggtc       240
     gacgcggtgc cgggtacgcc gttcggcgtg gtccacctcg acgtgccgcc cgtcacctcc       300
     ggcctggcga tcgggtcgct cgtcgcaggc atcgccgcga tcggggtgtc gctgctggtg       360
     ttgtgcttcg gtctggccgg ccgcgacgtc ggcggcgcct gggcggccgg cgcgttcaca       420
     gtgctcggcg ggctgatcgg cgccggcgcg gtggtggccg ggctgctcgc ccggcggcag       480
     atccggcggc cggcgccgcc gccgtcggtg cgcttcaccg gcgccggcct ggccgtggcg       540
     ggaatctcct gcggggcggc gggggtgctg ttcggcctga tcgggctcgc gctggctctg       600
     gtggtgcaga tcacgtga                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page