(data stored in SCRATCH zone)

EMBL: CP002399.PE63

CP002399.PE63        Location/Qualifiers
FT   CDS_pept        complement(65675..66166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0063"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: stp:Strop_0030 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05617"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADU05617.1"
FT                   /translation="MDQNVFDDPRITAVGLLVEAHAGLAARFAAQFEEHGLSPVEFEVL
FT                   TRLARSPNNQLRMTDLAAQTSLSTSGVTRVVDRMERDGLICRRACPSDRRSSFAVVTTA
FT                   GLSRLDDVLPGHLRIIEQWFTSQLDPAQLDGLLDGLRRVRDAVHPGATAGSTEPVEDAA
FT                   "
     gtggaccaga acgtgttcga cgacccccgg atcaccgccg tcggcctgct cgtcgaggcg        60
     cacgccgggc tcgccgcccg gttcgccgcc cagttcgagg agcacggcct ctccccggtc       120
     gagttcgagg tgctgacccg gctcgcccgc tcacccaaca accagctgcg gatgaccgac       180
     ctggccgcgc agacctcgct ctccaccagc ggcgtgaccc gcgtggtcga ccggatggag       240
     cgggacgggc tgatctgccg gcgtgcctgc ccgtccgatc ggcgcagttc cttcgcggtg       300
     gtgaccaccg ccgggctcag ccggctggac gacgtccttc ccggccatct gcggatcatc       360
     gagcagtggt tcaccagcca gctcgacccg gcgcagctcg acgggctgct ggacgggctg       420
     cgccgggtac gcgacgcggt ccatccgggc gccaccgccg gcagcaccga gccggtcgag       480
     gacgccgcct ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page