(data stored in SCRATCH zone)

EMBL: CP002399.PE645

CP002399.PE645       Location/Qualifiers
FT   CDS_pept        complement(659450..659641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06199"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU06199.1"
FT                   /translation="MSLKRFFLGTHRIKPLNIDLDGSPDRLAAALHGLAHMVRRRDDLD
FT                   GQRIRITVTIRIPEGDFE"
     atgtccctca agcgcttctt cctcggcacc caccgcatca agccgctgaa catcgacctc        60
     gacggctctc cggaccggct cgccgccgcc ctgcacggcc tggcgcacat ggtccgccgc       120
     cgggacgacc tcgacgggca gcgcatccgc attaccgtca ccatccgcat cccggagggc       180
     gacttcgaat ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page