(data stored in SCRATCH zone)

EMBL: CP002399.PE654

CP002399.PE654       Location/Qualifiers
FT   CDS_pept        complement(665707..665919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06208"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU06208.1"
FT                   /translation="MFRVGDVRSSGVVVTYLIGADALAPLVALHSTCRVGNCWAELSLS
FT                   QVTELIEHLRGLVEQANGDRGTSDE"
     atgttccggg ttggtgacgt ccgatcgagc ggagtcgtcg tcacctatct catcggtgct        60
     gacgccttgg cgccgttggt tgcgctgcac tcgacgtgcc gagtgggaaa ctgctgggcg       120
     gagttgtccc tgtcgcaggt gaccgaactg atcgagcatc tgcgcggcct ggtggagcag       180
     gctaacggtg accgtggaac cagcgatgag tga                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page