(data stored in SCRATCH zone)

EMBL: CP002399.PE658

CP002399.PE658       Location/Qualifiers
FT   CDS_pept        complement(672264..672791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0663"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_0676 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06212"
FT                   /inference="similar to AA sequence:KEGG:Rxyl_0676"
FT                   /protein_id="ADU06212.1"
FT                   /translation="MGSFNEPLSRLTSNRLNNLKSELERCGLEQITNEEYVQHLVAELS
FT                   LAAVTLSDGLPPEVTEGKDGLKVLVKTPASAGPVELLDKYDVEKPSYNEVLYIRDKAVH
FT                   SVRTFPHDAATDDVRAWVKAERERHHRIVKGFNDAALALNGQLQEMAQKIAAKRRAAGG
FT                   RASQLAADIQDL"
     atgggtagct tcaacgagcc gctgtcacgt ctgaccagca atcgtctaaa caacctgaag        60
     tccgagcttg agcgctgcgg cttggagcaa atcaccaatg aggagtacgt ccagcacctg       120
     gtcgccgaac taagtctggc cgcggttacg ctttccgacg gcttgccacc cgaggttaca       180
     gagggaaagg atgggctcaa ggtcctcgtc aagacgccgg cttcagcggg gcccgttgag       240
     ctgttggaca agtacgacgt tgagaagccg tcatacaacg aagtcctcta catccgtgac       300
     aaggccgtgc attcagtcag gaccttcccc cacgacgccg ccactgacga cgttcgagcg       360
     tgggtgaagg ccgaacgcga gcggcaccac cgaatcgtga agggcttcaa cgatgcagca       420
     ctcgcactga acggacagct gcaggagatg gcgcagaaga tcgctgcgaa gcggcgcgcc       480
     gcaggaggcc gcgcttccca gctggccgcc gacatccagg atctttag                    528
//

If you have problems or comments...

PBIL Back to PBIL home page