(data stored in SCRATCH zone)

EMBL: CP002399.PE679

CP002399.PE679       Location/Qualifiers
FT   CDS_pept        complement(697095..698942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0685"
FT                   /product="helicase domain protein"
FT                   /note="KEGG: saq:Sare_4341 helicase domain-containing
FT                   protein; PFAM: helicase domain protein; type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase
FT                   ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06233"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADU06233.1"
FT                   /translation="MTLPVQRDFFAAPSGVQHWMVGLRQVSRGADGMPGDRVPGDEFPG
FT                   SGFRAMREDAGVSGGPLIVQSDKTLLLEVDHPDAQACRMAIAPFAELERSPEHVHTYRL
FT                   TPLGLWNARAAGHDAEGVVDSLIKYSRYPVPHGLLVDVAETMDRYGRLQLANDPVHGLV
FT                   LRALDRVVLIEVAKSKKLAGMLGAKLDDDTVAVHPSERGRLKQALLKLGWPAEDLAGYV
FT                   DGEAHPIELAESGKDGGKPWTLRSYQREAVEAFWAGGSGVVVLPCGAGKTLVGAAAMAE
FT                   AKATTLILVTNTVAGRQWKRELIARTSLTEEEIGEYSGERKEIRPVTIATYQVLTSRRG
FT                   GAFTHLDLFGARDWGLVVYDEVHLLPAPIFRFTADLQARRRLGLTATLVREDGREGDVF
FT                   SLIGPKRYDAPWKDIEQQGWIAPAECTEVRVTLTDAERLAYATAEAEERYRMAATARTK
FT                   LPVVRALVDRHPSEQVLVIGGFLDQLHQLGEYLDAPIVQGSTTNKERERLFDAFRSGEI
FT                   RTLVISKVGNFSIDLPEAAVAIQVSGTFGSRQEEAQRLGRVLRPKADGRQAHFYTVVSR
FT                   DTIDTEYAAHRQRFLAEQGYAYTIVDADDVLGPSLPTVD"
     atgacgttgc ctgtccagcg agactttttt gcggcgccct ccggcgtgca acactggatg        60
     gtcggcctgc ggcaggtcag ccggggtgcg gacgggatgc cgggcgaccg ggttccgggc       120
     gacgagtttc cgggcagcgg gttccgggcg atgcgagagg acgctggcgt gagcggtgga       180
     ccactgatcg tgcagtcgga caagacgctg ctgctggagg tggatcaccc cgacgcgcag       240
     gcgtgccgga tggcgatcgc gccgttcgcc gagctggaac gctcccccga gcacgtgcac       300
     acctaccggc tcacgccgct tggcctgtgg aacgcccggg ccgccggcca cgacgccgag       360
     ggcgtggtcg actcgctgat caagtattcg cgctacccgg tgccgcacgg actgctcgtc       420
     gacgtggccg agacgatgga ccggtacggc cggctccagc tcgccaacga cccggtgcac       480
     ggcctggtgc tgcgcgcgct cgaccgggtg gtgctgatcg aggtcgccaa gagcaagaag       540
     ctcgccggca tgctcggcgc gaagctcgac gacgacaccg tcgcggtgca cccgtccgag       600
     cgggggcggc tcaagcaggc gctgctcaag ctgggctggc cggccgagga cctcgccggg       660
     tacgtggacg gcgaggcgca cccgatcgag ctggccgagt ccggcaagga cggcggcaag       720
     ccgtggacgc tgcggtcgta ccagcgggag gcggtcgagg cgttctgggc cggcgggtcc       780
     ggcgtggtgg tgctgccctg cggcgccggc aagacgctcg tcggggcggc ggcgatggcc       840
     gaggcgaagg cgaccacgct gatcctggtc accaacacgg tggcgggacg gcagtggaag       900
     cgggagctga tcgcccgcac gtcgctgacc gaggaggaga tcggcgagta ctcgggcgag       960
     cgcaaggaga tccgcccggt caccatcgcc acgtaccagg tgctcacctc acggcgcggc      1020
     ggcgcgttca cccacctgga cctgttcggc gcccgcgact ggggcctggt cgtctacgac      1080
     gaggtgcacc tgctgcccgc gccgatcttc cgcttcacgg cggacctcca ggcccgtcgc      1140
     cggctcggcc tcaccgcgac tctggtacgc gaggacggcc gcgagggcga cgtgttcagc      1200
     ctgatcggcc cgaagcggta cgacgcgccg tggaaggaca tcgagcagca gggctggatc      1260
     gccccggcgg agtgcaccga ggtacgggtg acgctcaccg acgccgagcg gctggcgtac      1320
     gcgacggcgg aggccgagga gcgctaccgg atggcggcga ccgcccgcac gaagctgccc      1380
     gtggtgcggg ccctggtgga ccggcacccg tccgagcagg tcctcgtcat cggcgggttc      1440
     ctcgaccagt tgcaccagct cggcgaatac ctggacgcgc cgatcgtgca gggctccacc      1500
     acgaacaagg agcgcgagcg gctgttcgac gcgttccgct ccggcgagat ccgcaccctg      1560
     gtcatctcca aggtcgggaa cttctccatc gacctgccgg aggcggcggt ggcgatccag      1620
     gtgtcaggca cgttcggctc ccggcaggag gaggcgcaac ggctcggccg ggtgctgcgc      1680
     ccgaaggccg acggccggca ggcgcacttc tacacggtgg tctcccggga caccatcgac      1740
     accgagtacg ccgcgcaccg gcagcggttc ctggccgagc aggggtacgc gtacaccatc      1800
     gtggacgccg acgacgtgct cgggccgtcg ctgcccacag tcgactga                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page