(data stored in SCRATCH zone)

EMBL: CP002399.PE680

CP002399.PE680       Location/Qualifiers
FT   CDS_pept        698991..699866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0686"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein;
FT                   Peptidoglycan-binding domain 1 protein; KEGG: sna:Snas_6098
FT                   ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06234"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ADU06234.1"
FT                   /translation="MQRVRFLARVTALAVVVLVGVGACALDPQAEGAGGSTPGPVGLTE
FT                   GASGASASPTPDQPVTSPSAQPSRTASPKPSRSPEATKTTKPKPKPSASAGCPQGEHQR
FT                   AVETYLTRLGGFGTLTVDGEQSAADCAAIKKFQIRYGISPSSGRAGPTTYDVAKRLAAT
FT                   DTARCRAGSRLTFCVDLTRQTVWAMRGGTVVMGPTVTRTGMSGYATPAGTYSVGRKNPR
FT                   EWSNPYEVWLPYWQQFNGGIGFHETTTYLHNGAIGSHGCVNLLHRDAVRLWELGSVGTR
FT                   VVVIGRRPGT"
     atgcagcgtg tccggtttct cgcccgggtc accgccctgg cggtggtcgt gctggtcggt        60
     gtcggcgcct gtgcgctcga tccgcaggcg gaaggcgccg gggggagcac ccccggcccg       120
     gtcgggctga cggagggagc atcgggggcg agcgcgtcgc ccacgccgga tcagccggtc       180
     acgtccccgt cggcgcagcc gagccggacg gcctcgccga aaccctcccg gtcgccggag       240
     gcgacgaaga cgacgaagcc caagccgaag ccgagcgcgt ccgccgggtg cccgcagggg       300
     gagcaccagc gggccgtgga gacgtacctg accaggctgg gcggcttcgg gacgctgacc       360
     gtggacggcg agcagtccgc cgccgactgc gcggcgatca agaagttcca gatccggtac       420
     gggatcagcc cgtcctccgg tcgcgccggc cccaccacgt acgacgtggc gaagcggctc       480
     gccgccaccg acaccgcgcg gtgcagggcc ggttcccggc tcaccttctg cgtcgacctg       540
     acccggcaga cggtctgggc gatgcgcggc ggcactgtgg tgatgggccc gacagtcacc       600
     cgcaccggca tgtccggcta cgccaccccg gccggcacgt actcggtggg ccggaagaac       660
     ccgcgcgagt ggtccaaccc gtacgaggtg tggctgccgt actggcagca gttcaacggt       720
     gggatcggct tccacgagac caccacctac ctgcacaacg gcgcgatcgg ctcacacggc       780
     tgcgtgaacc tgctgcaccg tgacgcggta cgcctgtggg agctgggctc ggtcggcacc       840
     cgcgtggtcg tgatcggccg ccgccccgga acctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page