(data stored in SCRATCH zone)

EMBL: CP002399.PE689

CP002399.PE689       Location/Qualifiers
FT   CDS_pept        complement(707190..708806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0695"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_0413 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06243"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADU06243.1"
FT                   /translation="MALSSRSGRSFLGRTVGTGIRATRLLLRGSLHGGRWMTRRAGTAR
FT                   ARSAGNEVGMVRLFDLHALSCAGDTLIAIGLAGTIFFDVPLGEARNKVALYLLVTMVPF
FT                   AMLAPVVGPLLDHFRHGRRYALATTMLGRAFLAWLISDYIGGFGLYPAAFGVLALSRAY
FT                   GVARSAAVPRLLPEGLGLSQVGARASVYGTVAGALVAPIGLAAFWFGPQWPLRVASVIF
FT                   LIGMVISLRLPPKADSEPPERMPHPLRALRRRDGERPLGRGRPSGRLVIATLIGAAALR
FT                   GLYGFLLLFLAFAIKAGDLTTDFFGRDLGAQGALGLVGGALAVGTFLATALGTRLRIHR
FT                   PTALQSSGTIVVAGVAVLAALKFSLPMVALLCLVAAMMSGIAKLAVDASIQERIPERLR
FT                   ASSFAHSETALMLAFVAGGGLGLVPFTGLIGVTVAAAVAALVAVRGVLVAGKLRGEHLA
FT                   GRPLGDEELAAEQATRAEKPATTSFDDPAPTSPAPQRSGPPPDDDGLAPPGFHIYRPSS
FT                   SVGGPGGVEDTERRDPRGPVA"
     atggcgctgt cctcccgctc cggccgctcc tttctcgggc ggaccgtcgg caccggcatc        60
     cgcgccaccc ggctgctgct gcggggctcg ctgcacggcg gacgctggat gacccggcgt       120
     gccggcacgg cccgggcccg cagcgccggc aacgaggtgg gcatggtccg cctgttcgac       180
     ctgcacgcgc tctcctgcgc cggtgacacg ctcatcgcga tcggcctggc cgggacgatc       240
     ttcttcgacg tgccgctggg cgaggcgcgc aacaaggtgg ccctctacct gctggtgacc       300
     atggtcccgt tcgccatgct cgccccggtg gtcggcccgc tgctcgacca cttccgccac       360
     ggccggcggt acgcgctggc caccaccatg ctgggccggg ccttcctggc ctggttgatc       420
     tccgactaca tcggcggctt cgggctctac ccggcggcgt tcggcgtgct cgcgctctcc       480
     cgggcgtacg gggttgcccg ctcggcggcg gtcccccggc tgctcccgga agggctgggg       540
     ctgtcccagg tcggggcgcg cgcgagcgtc tacggcactg tggccggcgc gctcgtcgca       600
     ccgatcggcc tggccgcgtt ctggttcggg ccgcagtggc cgctgcgggt cgcctcggtg       660
     atcttcctga tcggcatggt gatctcgctc cggctgccgc cgaaggccga ctccgagccg       720
     ccggagcgga tgccgcaccc gctgcgcgcg ctgcgccgcc gcgacggcga gcgcccgctg       780
     ggccggggtc gccccagtgg ccggctggtg atcgccacgc tgatcggcgc ggcggcgcta       840
     cgcgggctct acggcttcct gctgctgttc ctggccttcg cgatcaaggc cggtgacctg       900
     accaccgact tcttcggccg cgacctcggc gcccagggcg cgctgggcct ggtcggcggc       960
     gcgctggcgg tcggcacgtt cctggccacc gcgctcggca cccgtctgcg catccaccgg      1020
     ccgacagcgc tccagtccag cggcacgatc gtggtggccg gtgtggccgt gctcgccgcg      1080
     ctgaagttct cgctgccgat ggtggcgctg ctgtgcctgg tcgcggcgat gatgagcggg      1140
     atcgccaagc tggcggtgga cgcctcgatc caggaacgca tcccggagcg gctgcgcgcc      1200
     agctcgttcg cgcactcgga gaccgcgctg atgctcgcgt tcgtggccgg gggcgggctc      1260
     gggctggtgc cgttcaccgg cctgatcggg gtgaccgtcg ccgccgcggt ggccgcgctg      1320
     gtggccgtac gcggcgtgct cgtcgccggc aagctgcgcg gtgagcacct ggccggccgg      1380
     ccgctcggcg acgaggaact ggcggcggag caggcgaccc gcgccgagaa accggccacc      1440
     acctcgttcg acgacccggc gcccacgtca ccggcgcccc agcgctccgg cccaccgccg      1500
     gacgacgacg ggctggcccc gcccggcttc cacatctacc ggccgtcctc ctcggtgggc      1560
     gggccgggcg gcgtcgagga caccgagcgg cgcgaccccc gggggccggt ggcgtga         1617
//

If you have problems or comments...

PBIL Back to PBIL home page