(data stored in SCRATCH zone)

EMBL: CP002399.PE690

CP002399.PE690       Location/Qualifiers
FT   CDS_pept        708894..709733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0696"
FT                   /product="Protein of unknown function DUF3027"
FT                   /note="PFAM: Protein of unknown function DUF3027; KEGG:
FT                   saq:Sare_0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06244"
FT                   /inference="protein motif:PFAM:PF11228"
FT                   /protein_id="ADU06244.1"
FT                   /translation="MGNNGQVTRPASARAPRLDQVCAAAVEVARDAITEVEPTDIGDHL
FT                   QAVAEGDRVVTHYFECRMAGYRGWRWAVTVTRVPRSRHVTICETVLLPGPDALLAPGWL
FT                   PWQERLKPGDLGPGDLLPTPADDERLAPGYLLSDDPAVEETAWELGLGRARVLSREGRA
FT                   EAAQRWYDGDHGPDAAISAAAPAAARCGTCGFYLPLAGSLRLAFGACGNFYAPDDGRVV
FT                   SADHGCGAHSETMIEAAETSVDELPTVYDDSAVEAMTVSRAPGSVEAAEPAEPYGHP"
     atggggaaca atggtcaggt gaccaggccc gcctccgccc gcgctccccg gctcgaccag        60
     gtctgcgccg ccgccgtcga ggtggcccgc gacgcgatca ccgaggtgga gcccaccgac       120
     atcggcgatc atctccaggc ggtcgccgag ggcgaccggg tcgtcaccca ctacttcgaa       180
     tgccggatgg ccggttaccg cggctggcgc tgggccgtca ctgtgacccg ggtgccgcgc       240
     agccggcacg tcaccatctg cgagacggtg ctgctgcccg gcccggacgc gcttctcgct       300
     ccgggctggc tgccctggca ggagcggctc aagccgggcg acctgggtcc gggcgacctg       360
     ctgcccaccc cggccgacga cgagcggctc gcccccggct acctgctctc cgacgacccc       420
     gcagtggagg agaccgcctg ggagctgggc ctgggccggg cccgggtgct gtcccgggag       480
     ggccgcgccg aggccgccca gcggtggtac gacggggacc acggcccgga cgccgccatc       540
     tcggccgccg cgccggccgc cgcacgctgc ggcacctgcg gtttctacct gccgctcgcc       600
     ggttcgctgc gcctggcgtt cggcgcctgc ggcaacttct acgcccctga cgacggtcgg       660
     gtggtgagcg ccgaccacgg ttgcggcgcg cactcggaga cgatgatcga agcggccgag       720
     acgtccgtgg acgagctgcc caccgtctac gacgacagcg cggtcgaggc catgaccgtc       780
     agccgggccc cgggctcggt ggaggcggcc gaaccggcgg agccgtacgg ccacccctga       840
//

If you have problems or comments...

PBIL Back to PBIL home page