(data stored in SCRATCH zone)

EMBL: CP002399.PE692

CP002399.PE692       Location/Qualifiers
FT   CDS_pept        710094..711575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0698"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   stp:Strop_0416 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06246"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADU06246.1"
FT                   /translation="MSIAPPPDHGTPPDPAHPRNAFDRFFLISARGSTLSRELRGGFAT
FT                   FFTMAYIVVLNPLILGSGKDGDGRSLAIPALAAATALVAGLMTILMGVVARFPIALAAG
FT                   LGVNALVAYEIAPQMTWADAMGLVVIEGVLIGILVLTGLRTAVFRSVPTQLKTAIGVGI
FT                   GLFLTIIGLVDAGFVRRVPDAANSTVPVGLGINGKIVSWPMLVFVVGLLITLVLVVRRV
FT                   RGAILIGILASTVLAIVVEAIADVGPSFVDGKPNPKGWALNVPELPKQIVDLPDLSLLG
FT                   QFNVLNSWSRVGWLVPLMFIFTLLITDFFDTMGTMVAIGQEGDMLDETGTPPKAKEILL
FT                   VDSIAAAAGGAASVSSNTSYIESAAGVAEGARTGVANLVTGALFLLAMFLAPLSLIVPF
FT                   EAASTALVVVGFLMMTAVRTIDWTDYEIAVPAFLTIALMPFTYSISNGIGAGVISFVLL
FT                   KVAKGKAREVHPLLYGVAVLFIVYFLRGPVESVLL"
     atgtccattg ccccgccgcc ggatcacggc acaccgcccg atcccgcgca tccacgaaac        60
     gccttcgacc gcttcttcct gatctcggcg cgcgggtcga cgctgagccg ggagttgcga       120
     ggcggcttcg ccacgttctt cacgatggcg tacatcgtgg tgttgaaccc gctgatcctg       180
     ggcagcggta aggacggcga cggccgttcg ctggccatcc cggcgctcgc cgcggcgacc       240
     gcgctggtcg ccggcctgat gaccatcctg atgggcgtgg tggcccggtt cccgatcgcg       300
     ctcgcggccg gcctgggcgt gaacgcgctc gtcgcctatg agatcgcgcc ccagatgacc       360
     tgggcggacg cgatgggcct ggtggtcatc gagggtgtgc tgatcggcat cctggtgctc       420
     accggactgc gtaccgcggt gttccgctcg gtgcccacgc agctcaagac cgcgatcggc       480
     gtcggcatcg gtctgttcct gaccatcatc ggcctggtcg acgccggttt cgtcaggcgc       540
     gtgccggacg ccgcgaactc cacggtgccg gtcgggctgg gcatcaacgg caagatcgtc       600
     agctggccga tgctcgtctt cgtggtcggc ctgctgatca cgctggtcct ggtggtacgc       660
     cgggtccgcg gcgcgatcct gatcggcatc ctggcctcca ccgtgctggc catcgtggtc       720
     gaggcgatcg ccgacgtcgg cccgtccttc gtcgacggca agccgaaccc gaagggctgg       780
     gcgctgaacg tgcccgagct gcccaaacag atcgtggacc tgcccgacct gtcgctgctg       840
     ggccagttca acgtgctgaa ctcgtggagc cgggtcggct ggctggtgcc gctgatgttc       900
     atcttcacgc tgctgatcac ggacttcttc gacaccatgg gcacgatggt cgcgatcggc       960
     caggaagggg acatgctcga cgagacgggc accccgccga aggccaagga gatcctgctg      1020
     gtcgactcga tcgccgccgc cgcgggtggc gcggcctcgg tgtccagcaa cacgtcgtac      1080
     atcgagagcg ccgcaggcgt cgcggagggt gcccggaccg gcgtggccaa cctggtcacc      1140
     ggcgcgttgt tcctgctcgc tatgttcctc gcgccgctgt cgctgatcgt gccgttcgag      1200
     gccgcgtcga cggcgcttgt ggtggtcggc ttcctgatga tgacggcggt ccgcacgatc      1260
     gactggaccg actacgagat cgccgtcccg gcgttcctca ccatcgcgct gatgccgttc      1320
     acctattcga tctcgaacgg catcggggcc ggcgtgatca gcttcgtgct gctgaaggtg      1380
     gccaagggta aggcccggga ggtccacccg ctcctgtacg gggtcgccgt gctgttcatc      1440
     gtgtacttcc tgcgcgggcc ggtcgagtcc gtgttgctct ga                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page