(data stored in SCRATCH zone)

EMBL: CP002399.PE697

CP002399.PE697       Location/Qualifiers
FT   CDS_pept        complement(714663..715649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0703"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sna:Snas_1656
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06251"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU06251.1"
FT                   /translation="MEYTNLGRTGLSVSRLCLGTMNFGPQTDEPDSFAIMDRALEHGIN
FT                   FFDTANVYGWKLGEGVTEQIVGRWFAQGGGRRDKVVLATKVYGKMGEWPNEQGLSARHI
FT                   IRACEDSLRRLQTDTIDLYQMHHISRTTPWEEIWQAMETLVAQGKVLYVGSSNFAGWHI
FT                   AQAQAAAGKRNFLGLVSEQCIYNLLTRYVELEVVPAAQHYGLGIIPWSPLHGGLLSGII
FT                   RKMAEGSAARGTTGRSADALAEHRNTIEAYEKLCADLGHDPADVALAWLLSRPGVTAPI
FT                   VGPRTMDQLDRNLGALDVQLDESTLTRLDELFPPVGNGGPGPEAWAW"
     atggagtaca cgaacctggg acgcaccggt ctgtccgtga gccgactctg cctcggcacg        60
     atgaacttcg gtccgcagac cgacgagccg gacagtttcg ccatcatgga ccgggcgctc       120
     gaacacggga tcaacttctt cgacaccgcg aacgtctacg gctggaagct cggtgagggc       180
     gtcaccgagc agatcgtcgg ccgctggttc gcgcagggcg gcgggcgccg cgacaaggtc       240
     gtcctcgcca ccaaggtgta cggcaagatg ggcgagtggc ccaacgagca gggcctgagc       300
     gcccggcaca tcatccgggc ctgcgaggac tcgctgcgcc ggctccagac cgacacgatc       360
     gacctctacc agatgcacca catctcccgg accacgccgt gggaggagat ctggcaggcg       420
     atggagacgc tcgtcgccca gggcaaggtg ctctacgtcg gatcgtccaa cttcgccggc       480
     tggcacatcg cgcaggcgca ggccgcggcc ggcaagcgca acttcctcgg gctcgtctcc       540
     gagcagtgca tctacaacct gctgacccgg tacgtcgaac tggaggtcgt cccggccgcg       600
     cagcactacg ggctgggcat catcccctgg tcgccgctgc acggcgggct gctctccggc       660
     atcatccgca agatggccga gggcagcgcg gcgcgcggca ccaccggccg ctcggccgac       720
     gcgctggccg agcaccggaa caccatcgag gcgtacgaga agctctgcgc cgacctgggc       780
     cacgacccgg cggatgtggc gctggcgtgg ctgctgtccc ggccgggcgt gaccgccccg       840
     atcgtcggcc cgcgcaccat ggaccagctc gaccgcaacc tcggtgccct agacgtccag       900
     ctggacgagt cgacgctgac ccgcctcgac gagctgttcc cgccggtcgg caacggcggt       960
     cccggccccg aggcctgggc ctggtag                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page