(data stored in SCRATCH zone)

EMBL: CP002399.PE698

CP002399.PE698       Location/Qualifiers
FT   CDS_pept        complement(715713..716801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0704"
FT                   /product="Protein of unknown function DUF3071"
FT                   /note="PFAM: Protein of unknown function DUF3071; KEGG:
FT                   saq:Sare_0509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06252"
FT                   /inference="protein motif:PFAM:PF11268"
FT                   /protein_id="ADU06252.1"
FT                   /translation="MRPVRFVALSEDGQALVLADEVGRLLALPIDERIASALHAEPGAP
FT                   PLAVVPSATDPTPSLSPRDIQARIRSGESAEDVARIAGVPVDRVLRYAGPVLQERAMLA
FT                   QHARRTRLKGAEKPTPLAEVVNGRLAQHGIDTEKISWDAYRRDDGTWRIIATWPSGKAT
FT                   AQAVWDLDKTRQNVAPHDDMAQYLCAERPTPILGQEPAPERGGHALPGPSRGEPSRGGH
FT                   GLPAASEHARPGRDPIRAGRDALLASLDRPLGGTSGRGLDTRSPAALAGQEAPRQRAVA
FT                   GGAAALLGGGQGSAFDDDSDAPKEIPAVPSLAVLRPRRTGPAAATGGAAAESTDAGGKP
FT                   RKRLPSWDDVLFGTGPAARESS"
     atgcgcccag tacgcttcgt cgccctctcc gaggacggcc aggccctggt gctcgccgac        60
     gaggtggggc gcctgctggc gctgcccatc gacgagcgga tcgcgtcggc gctgcacgcc       120
     gagccgggcg ccccgccgct cgctgtggtg ccgagcgcca ccgacccgac gccgtcgctg       180
     tccccacgcg acatccaggc ccggatccgg tccggcgagt ccgcggagga cgtcgcccgc       240
     atcgccggcg taccagtcga ccgggtgctg cgttacgccg gtccggtgct ccaggagcgg       300
     gccatgctcg cccagcacgc ccgccgcacc cggctcaagg gcgcggagaa gccgaccccg       360
     ctggccgagg tcgtcaacgg ccggctggcc cagcacggca tcgacaccga gaagatctcg       420
     tgggacgcct accgccgcga cgacggcacc tggcggatca tcgcgacctg gccgtccggc       480
     aaggccaccg ctcaggcggt gtgggatctg gacaagaccc ggcagaacgt cgccccgcac       540
     gacgacatgg cgcagtacct gtgcgccgag cggcccacgc cgatcctcgg ccaggagccg       600
     gcgccggagc ggggcggtca cgcgctgccc ggcccgtcgc gcggcgagcc gagccggggt       660
     gggcacggcc tgccggctgc ctccgagcac gcccgtccgg ggcgtgaccc gatccgcgcc       720
     ggccgggacg cgttgctcgc ctcgctggac cggccgctcg gcggcacgtc cgggcgtggt       780
     ctcgacaccc gctccccggc cgcgctggcc gggcaggagg cgccccgcca gcgggccgtc       840
     gccggtggtg ccgccgcgct gctcggtggt gggcagggtt cggccttcga cgacgactcg       900
     gacgcgccca aggagatccc ggccgtaccc tcgctcgccg tgctgcggcc ccgccgcacc       960
     ggccccgcgg cggcgaccgg cggtgcggca gccgagtcca cggatgccgg tggcaagccg      1020
     cgcaagcggt tgccgagctg ggacgacgtg ctgttcggca ccggcccggc ggcccgcgaa      1080
     tcatcctga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page