(data stored in SCRATCH zone)

EMBL: CP002399.PE701

CP002399.PE701       Location/Qualifiers
FT   CDS_pept        719753..720412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0707"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="TIGRFAM: pyridoxamine 5'-phosphate oxidase; KEGG:
FT                   stp:Strop_0424 pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   Pyridoxine 5'-phosphate oxidase, dimerisation-like"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06255"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ADU06255.1"
FT                   /translation="MTGDTPAPAGMRNEYAADLGLTETDLAPDWHTQFARWFADAVAHQ
FT                   LPEPNAMVLGTADDRGRPSGRTVLLKGYGPEGFVFYTNHGSRKGAEVIGNPWASLVFPW
FT                   FPMQRQVIVTGRVEQVDRAETEAYFATRPRGSQLGAWASAQSTVVPDRTALDAAYRAAA
FT                   ERFADVDPIPAPPYWGGFRVRPETVEFWQGRASRLHDRLRFRRTGDGFFVVERLAP"
     gtgacaggcg acacacccgc cccggccggc atgcgtaacg agtacgcggc cgatctgggc        60
     ctgaccgaga cggacctggc gccggactgg cacacccagt tcgcccgctg gttcgccgac       120
     gcggtggccc atcagctgcc cgagccgaac gcgatggtgc tcggcacggc cgacgaccgg       180
     ggccggccca gcgggcgcac cgtgctgctc aagggatacg gcccggaggg cttcgtcttc       240
     tacaccaacc acggctcgcg caagggcgcc gaggtgatcg ggaacccgtg ggccagcctg       300
     gtgttcccct ggttcccgat gcagcggcag gtgatcgtga ccggccgggt cgagcaggtg       360
     gaccgggccg agaccgaggc gtacttcgcg actcggccgc gcggctcgca gctcggggcg       420
     tgggccagcg cccagtcgac ggtggtgccg gaccggaccg cgctcgacgc ggcgtaccgg       480
     gcggcggccg agcggttcgc cgacgtggac ccgatccccg cgccgccgta ctggggcggg       540
     ttccgggtcc gtccggagac tgtcgagttc tggcagggcc gggccagccg gctgcacgac       600
     cggctgcgct tccggcgtac cggggacggg ttcttcgtcg tcgagcggct cgcgccgtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page