(data stored in SCRATCH zone)

EMBL: CP002399.PE709

CP002399.PE709       Location/Qualifiers
FT   CDS_pept        726834..728204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0715"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="TIGRFAM: L-serine dehydratase 1; KEGG: saq:Sare_0518
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06263"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ADU06263.1"
FT                   /translation="MISVFDLFSVGIGPSSSHTVGPMRAARTFVAGLKADGMLADVARV
FT                   RAELFGSLGATGHGHGSDRAVLLGLEGEVPETVDTDSVGPRVERIRTQRRLDLFGSQGV
FT                   DFDPDTDLVLHRRRSLPYHPNGMTFAAYDAAGGEVRTRTYYSVGGGFVVDEAAAGADRI
FT                   KADSTRVRHPFLTGAELLTVTSETGLSISEVMLANEVSWRSEADVRAGLLEIWRVMREC
FT                   VENGCTRDGVLPGGLKVRRRAAEMRRGLEAETGSGDPLRAMDWVTLFALAVNEENAAGG
FT                   RVVTAPTNGAAGIIPAVLHYYTRFVPGASEEGVVRFLLAAGAIGVLFKENASISGAEVG
FT                   CQGEVGSACSMAAAGLAEALGGTPEQVENAAEIGMEHNLGLTCDPVGGLVQIPCIERNA
FT                   VASIKAITAARLALRGDGVHHVSLDKVIKTMRETGADMKVKYKETARGGLAVNVIEC"
     atgatcagtg ttttcgatct tttcagcgtc ggtatcgggc cgtccagctc gcacaccgtc        60
     gggccgatgc gggccgcccg tacgttcgtg gcgggtctga aggccgacgg gatgctcgcg       120
     gatgtggcgc gggtacgggc ggagctgttc ggctcgctcg gcgcgaccgg ccacgggcac       180
     ggcagtgacc gggcggtgct gctggggctg gagggtgagg tcccggagac tgtcgacacg       240
     gactcggtcg ggccgcgggt ggagcggatc cgcacgcagc ggcggctcga cctgttcggc       300
     agtcaggggg tcgacttcga tccggacacg gatctggtgc tgcatcgccg gcggtcgttg       360
     ccgtatcacc cgaacgggat gacgttcgcg gcgtacgacg cggccggggg cgaggtgcgg       420
     acgcgcacgt actactcggt cggtggcggg ttcgtggtgg acgaggcggc ggccggggcg       480
     gaccggatca aggcggacag cacccgggta cggcacccgt tcctgaccgg tgcggagttg       540
     ctgaccgtca cctcggagac cgggctgtcg atcagtgagg tgatgctcgc caacgaggtg       600
     tcctggcgta gcgaggcgga cgtgcgcgcc gggctgctgg agatctggcg ggtgatgcgc       660
     gagtgcgtgg agaacggctg cacccgtgac ggcgtactcc cgggtgggtt gaaggtccgg       720
     cggcgcgcgg cggagatgcg gcgcggcctg gaggcggaga ccggcagcgg ggatccgctg       780
     cgcgcgatgg actgggtgac gttgttcgcg ctggcggtca acgaggagaa cgcggccggc       840
     gggcgggtgg tcaccgcgcc gacgaatggt gctgccggga tcatcccggc tgtgctgcac       900
     tactacaccc ggttcgtgcc gggtgcctcc gaggagggcg tggtccggtt tctgctggcg       960
     gcgggcgcga tcggtgtgtt gttcaaggag aacgcgtcga tctccggtgc cgaggtgggc      1020
     tgtcagggtg aggtgggttc ggcgtgctcg atggcggcgg ccgggctggc cgaggcgctg      1080
     ggcggtacgc cggagcaggt ggagaacgcc gctgagatcg gcatggagca caacctgggg      1140
     ttgacctgcg atccggtggg tggcctggtg cagattccgt gcatcgagcg caacgcggtg      1200
     gcgagcatca aggcgatcac cgcggcccgg ctggcgttgc ggggcgacgg ggtgcaccac      1260
     gtgtcgctgg acaaggtcat caagaccatg cgggagaccg gcgcggacat gaaggtcaag      1320
     tacaaggaga ccgcgcgggg cgggctcgcc gtcaacgtga tcgagtgctg a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page