(data stored in SCRATCH zone)

EMBL: CP002399.PE716

CP002399.PE716       Location/Qualifiers
FT   CDS_pept        complement(735803..736072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0722"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_4867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADU06270"
FT                   /inference="similar to AA sequence:KEGG:Sare_4867"
FT                   /protein_id="ADU06270.1"
FT                   /translation="MRLRWFRCRGASAPTLPHRVRGDNLPEWMRQPTRPLPTMGPGRVG
FT                   NLTPAQQWRANGGRWSVPEQRGNGGGHRSAPEQRPGDGHHEERR"
     gtgcgactgc gctggttccg ctgccggggt gcgtcggcac cgacactgcc ccaccgggta        60
     cggggcgaca acctgccgga gtggatgcgg cagccgacgc gtccactgcc gacgatgggc       120
     ccgggccggg tcggcaacct caccccggcg cagcagtggc gggcgaacgg cggtcgctgg       180
     tccgtaccgg agcagcgcgg gaacggcggc ggccatcggt ccgccccgga gcagcgcccg       240
     ggagacggcc accacgagga gcgccggtga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page