(data stored in SCRATCH zone)

EMBL: CP002399.PE8

CP002399.PE8         Location/Qualifiers
FT   CDS_pept        complement(7776..8330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05562"
FT                   /inference="similar to AA sequence:KEGG:Strop_0007"
FT                   /protein_id="ADU05562.1"
FT                   /translation="MGLDNVAVHWPRTGRFYDPVAPAEFVDFGEIVDMPRISAPTAALA
FT                   ELIAKTGTVRATAYTELVDLILGLENVLYATENAVEDEDPVIDPDGCSWIAEGVEKFVA
FT                   RHRPYGEPVTFESVSEVLRALLGDGRLAEQQLRWLDSRLDRLRDESGDPPQWNFTCAEL
FT                   SVLAAFYRRCAERGFAVYADA"
     atggggctgg acaacgtcgc ggtgcactgg ccgcggaccg gccgcttcta cgatccggtc        60
     gcgccggctg agttcgtgga cttcggcgag atcgtggaca tgccccggat ctccgcgccg       120
     accgcggcgc tcgccgagct gatcgcgaag accggcacgg tacgcgcgac cgcgtacacg       180
     gaattggtcg atttgatcct cgggctggag aatgtgctct acgccacgga gaacgcggtc       240
     gaggacgagg acccggtgat cgacccggac ggctgctcct ggatcgccga gggcgtggag       300
     aagttcgtcg cacggcaccg gccgtacggc gagccggtca cgttcgagtc ggtgagcgag       360
     gtgctgcgcg cgctgctcgg cgacgggcgg ctggccgagc agcagctccg ctggctcgac       420
     agccggctcg accggctgcg ggacgagagc ggcgatccgc cgcagtggaa cttcacctgc       480
     gccgagctga gcgtgctggc ggccttctac cggcgctgcg cggagcgggg cttcgcggtc       540
     tacgccgacg cctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page