(data stored in SCRATCH zone)

EMBL: CP002399.PE85

CP002399.PE85        Location/Qualifiers
FT   CDS_pept        complement(87782..88054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05639"
FT                   /inference="similar to AA sequence:KEGG:Strop_0050"
FT                   /protein_id="ADU05639.1"
FT                   /translation="MYSWIWRKLPFGLPGKLFGSLVLATATVALLWFVVFPWAEPLLPF
FT                   DDVQVTQDSGVPGDGGITEPTGLPGEEELPYSTETNNAPPSTPNR"
     gtgtactcgt ggatctggcg caaactcccg ttcgggctgc ccggcaagct gttcggctcg        60
     ctggtgctgg ccaccgccac cgtcgcgctg ctctggttcg tggtcttccc gtgggccgag       120
     ccgctgctgc ccttcgacga cgtgcaggtc acccaggact ccggcgtacc gggtgacggt       180
     gggatcaccg agccgaccgg gctgcccggc gaggaggagc tgccgtacag caccgagacg       240
     aacaacgccc caccctccac cccgaacagg tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page