(data stored in SCRATCH zone)

EMBL: CP002399.PE87

CP002399.PE87        Location/Qualifiers
FT   CDS_pept        complement(89752..90558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0087"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   saq:Sare_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05641"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ADU05641.1"
FT                   /translation="MEYTSGAASWQKVLRRAAAALLPRRARQRRPGWSVGVPLIAAAAG
FT                   LLFTTTATTAGGTSLREDRRPQLTQLIEDRREEVAASEAKAARLRAEVEEQTEALAGAD
FT                   GPIKTERDRAAASRQGAGFTALTGSGVTVELNDADRRPDQPLPKGASNDDLVVHQGDVQ
FT                   AVVNALWAGGAEAMSIMNVRVLSTSAVRCVGNTLLLHGRVYSPPFKIVAIGDPAELQRA
FT                   LAASEGVRVFKEVADHYQLGYVERVSTVTVPAFEDSTALQSATVPR"
     gtggagtaca cgtccggcgc cgcctcctgg cagaaggtcc tccgccgcgc ggcagccgcc        60
     ctgctgcccc ggcgcgcacg ccagcgccgc cccggctggt ccgtcggcgt acccctgatc       120
     gccgccgcgg ccggtctgct gttcaccacc accgccacca ccgcgggcgg cacctccctg       180
     cgtgaggacc gccggcctca gctgacccag ctgatcgagg accgccgcga ggaggtcgcc       240
     gccagcgagg cgaaggccgc ccggctccgg gccgaggtgg aggagcagac cgaagcgctc       300
     gccggcgccg acgggccgat caagaccgag cgggaccggg ccgccgccag ccggcagggc       360
     gccgggttca cagcgctcac cggcagcggc gtgaccgtcg agctgaacga cgccgaccgc       420
     cggcccgacc agccgctgcc gaagggcgcc agcaacgacg acctggtggt gcaccagggc       480
     gacgtccagg cggtcgtcaa cgcgctctgg gccggcggcg cggaagccat gtcaatcatg       540
     aacgtccgcg tgctgagcac cagcgcggta cgctgcgtcg gtaacaccct gctgctgcac       600
     ggccgggtgt actcccctcc tttcaagatc gtggcaatcg gcgatcccgc ggaactccag       660
     cgggcgctcg ccgcctctga gggagtgcgg gtgttcaagg aagtggccga ccactaccaa       720
     ctcgggtacg tcgagcgcgt ctccaccgtc accgtgccgg cgttcgagga ctccaccgcg       780
     ttgcaatcgg cgacggtgcc ccggtga                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page