(data stored in SCRATCH zone)

EMBL: CP002399.PE89

CP002399.PE89        Location/Qualifiers
FT   CDS_pept        91233..93431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0089"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: saq:Sare_0059
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05643"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADU05643.1"
FT                   /translation="MGSVQIVTTILAAAITAVAVWLAVRAVMKMTAVIRLGQPAPERFG
FT                   DKGARTKKMLVETAGHTRMLKWSVVGAAHWFVMVGFIVLSLLVLEAYFEVVSTGGGLPI
FT                   IGHWTIFGLVTEWIGILGLVGILVLMAIRLRNRPGRAENRSRFTGSTMWQGYFVEWVVL
FT                   LVLIFGFVIRGFKVATDHFEYPVWAAPLSHAVGSVLPDWEAGVSVAALIKIAISMTWLI
FT                   VISLNVTMGVAWHRFLAFPNIFFKRDPEKPAGSGLGPLRPMTSEGKPLDFEEADPEKDQ
FT                   FGVAQVEQFTWKGLLDFSTCTECGRCQSQCPAWNTGKPLSPKLLVLSLRDHAYAKAPYL
FT                   LAGGGKDLTGEEKATQEQLAGVDVLAMAEADRPLIGTAEEGGVIDPDVLWSCTTCGACV
FT                   EQCPVDIEHVDHIVDMRRYQVLIESSFPSEAGVMLRNLENKGNPWGAPQNTREDWTKGL
FT                   GFEVPRVGEVDDFEYLFWVGCAGAFEDRAKKTTRAVATLLNEAGVKFAILGEGETCSGD
FT                   PARRIGNEFVFQMLAQQNVETLNEAFEGREKSKRKIVATCPHCFNTLGNEYGQLGGEFE
FT                   VVHHTQLLAHLVSAGKLTPVQPVDGGVTYHDPCYLGRHNRIFAAPREVLGDSIQGELTE
FT                   MPRNSERSFCCGAGGARMWMEEKIGKRINVDRVEEAMSTGAKTIAVGCPFCSTMLNDGV
FT                   NGKGAGEQVEVVDVASVLLRSVKPEAPAGEPEVAPTAS"
     atgggcagcg tccagatcgt caccacgatc ctcgcggccg ccatcaccgc cgttgcggtg        60
     tggcttgcgg tgcgcgcggt catgaagatg accgccgtca tccggctcgg ccagcccgcg       120
     ccggagcggt tcggcgacaa gggcgcgcgt acgaagaaga tgctggtgga gaccgccggt       180
     cacacccgca tgctcaagtg gagcgtggtc ggcgccgccc actggttcgt gatggtcggc       240
     ttcatcgtgc tgtcgctgct ggtgctggag gcctacttcg aggtcgtctc caccggcggt       300
     gggctgccga tcatcgggca ctggacgatc ttcggtctgg tcaccgagtg gatcggcatc       360
     ctcggcctgg tcggcatcct ggtgctgatg gcgatccggc tgcgcaaccg gcccggccgc       420
     gcggagaacc gctcccggtt caccggctcg accatgtggc agggctactt cgtcgagtgg       480
     gtcgtcctgc tggttctgat cttcgggttc gtgatccggg gcttcaaggt cgccaccgac       540
     cacttcgagt acccggtctg ggccgccccg ctcagccacg cggtcggctc ggtcctcccg       600
     gactgggagg cgggcgtcag cgtcgccgcg ctcatcaaga tcgccatttc gatgacctgg       660
     ctcatcgtga tctcgctgaa cgtcaccatg ggcgtggcct ggcaccgctt cctggccttc       720
     ccgaacatct tcttcaagcg cgacccggag aagccggccg gttccggcct gggcccgctg       780
     cgcccgatga ccagcgaggg caagccgctg gacttcgagg aggccgaccc ggagaaggac       840
     cagttcggtg tcgcccaggt cgagcagttc acctggaagg gcctgctcga cttcagcacc       900
     tgcaccgagt gcggtcgctg ccagtcgcag tgccccgcct ggaacaccgg caagccgctg       960
     tcgccgaagc tgctggtgct gagcctgcgt gaccacgcgt acgccaaggc gccgtacctg      1020
     ctggccggtg gcggcaagga cctcaccggc gaggagaagg ccacgcagga gcagctggcc      1080
     ggcgtggacg tgctggccat ggccgaggcg gaccggccgc tgatcggcac cgccgaggag      1140
     ggcggtgtca tcgacccgga cgtgctctgg tcctgcacca cctgcggcgc ctgcgtcgag      1200
     cagtgcccgg tcgacatcga gcacgtggac cacatcgtcg acatgcgccg ctaccaggtg      1260
     ctgatcgagt cgagcttccc gtccgaggcc ggcgtcatgc tccgcaacct ggagaacaag      1320
     ggcaacccgt ggggcgcccc gcagaacacc cgcgaggact ggaccaaggg cctcgggttc      1380
     gaggtgccgc gcgtcggcga ggtcgacgac ttcgagtacc tcttctgggt cggctgtgcc      1440
     ggcgcgttcg aggaccgggc caagaagacc acccgcgcgg tcgccacgct gctgaacgag      1500
     gcgggcgtca agttcgccat cctcggtgag ggcgagacct gctccggcga cccggcgcgc      1560
     cgcatcggca acgagttcgt cttccagatg ctggcccagc agaacgtcga gacgctgaac      1620
     gaggcgttcg agggccggga gaagagcaag cgcaagatcg tcgccacctg cccgcactgc      1680
     ttcaacaccc tgggcaacga gtacggccag ctcggcggcg agttcgaggt ggtgcaccac      1740
     acccagctgc tggcccacct ggtcagcgcc ggcaagctca ccccggtgca gccggtcgac      1800
     ggcggcgtga cctaccacga cccgtgctac ctgggccgcc acaaccggat cttcgccgcc      1860
     ccgcgcgagg tgctcggcga ctcgatccag ggcgagctga ccgagatgcc gcgtaacagc      1920
     gagcgctcct tctgctgcgg cgccggcggc gcccggatgt ggatggagga gaagatcggt      1980
     aagcggatca acgtggaccg ggtcgaggag gccatgtcca ccggggcgaa gaccatcgcg      2040
     gtcggctgcc cgttctgctc gacgatgctg aacgacggcg tgaacggcaa gggcgcgggc      2100
     gagcaggtcg aggtggtcga cgtggcgagc gtgctgctgc gctcggtcaa gccggaggcc      2160
     ccggccggtg agccggaggt cgcgccgacc gcgagctga                             2199
//

If you have problems or comments...

PBIL Back to PBIL home page