(data stored in SCRATCH zone)

EMBL: CP002399.PE95

CP002399.PE95        Location/Qualifiers
FT   CDS_pept        100235..101266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0095"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: stp:Strop_0055 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05649"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADU05649.1"
FT                   /translation="MALHAPRPSSSRSVDRSTAVPRTRWSRFTTALAALVGTAVVLTGG
FT                   ATAAHAEPSVAEIEAQIDRDWNKLEPVIEQVNAVREQLAARRKQADALGRQIAPLQARV
FT                   DAALGQVGGLAADAYKGDNLSTVNALLGSRSPGDLVNGLELLDRFAHRQHEQVRSVAAL
FT                   RDELAAKKKPLDEMIAGLARTEAQLAAKKKQIDAEIARLQKLRLKVYGNGGGGPLRPAP
FT                   CPAGYPGGAAGAAVKFACAQIGKIYVWGAAGPDHFDCSGLTMAAWAKGGVSLPHNARQQ
FT                   HGMTKRVSRAELRAGDLVFYYSDLHHVAMYVGDGWVVHASQSGKPITMKRVDDGDINSY
FT                   GRV"
     gtggcactcc atgccccgcg gccgtcgtcg agccggtcgg tcgaccgctc cacggctgtg        60
     ccgcgtaccc gctggtcccg cttcaccaca gccctcgccg ccctcgtcgg caccgcagtc       120
     gtcctgaccg gcggcgccac ggcggcacac gccgaaccct cggtcgccga gatcgaggcg       180
     cagatcgacc gcgactggaa caaactcgaa ccggtcatcg aacaggtcaa cgccgtacgc       240
     gagcagctcg ccgcgcggcg caagcaggcc gacgcgctcg gccggcagat cgcacccctc       300
     caggcccggg tggacgccgc gctcggccag gtcggcggac tcgccgccga cgcctacaag       360
     ggtgacaacc tctccaccgt caacgcgctg ctgggcagcc gctcacccgg tgacctggtc       420
     aacggcctgg aactgctcga ccgcttcgcg caccgccagc acgagcaggt gcgctccgtc       480
     gccgcgctgc gcgacgaact ggcggcgaag aagaagccgc tggacgagat gatcgccgga       540
     ctggcgcgta ccgaggccca gctcgcggcg aagaagaagc agatcgacgc cgagatcgcc       600
     cggctgcaga agctgcggct caaggtgtac ggcaacggtg gcggcggccc gctgcgcccg       660
     gcgccctgcc ccgccggtta ccccggtggc gcggccggag cggcggtcaa gttcgcctgc       720
     gcccagatcg gcaagatcta cgtgtggggc gcggccgggc cggatcactt cgactgctcg       780
     ggcctgacca tggcggcctg ggccaagggc ggtgtctcgc tgccgcacaa cgcgcgccag       840
     cagcacggca tgacgaagcg ggtgagccgg gccgagctgc gcgccggtga cctcgtcttc       900
     tactacagcg acctgcacca cgtggcgatg tacgtgggcg acggctgggt ggtgcacgcc       960
     tcccagtccg gcaagcccat caccatgaag cgggtcgacg acggcgacat caacagctac      1020
     ggccgggtgt aa                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page