(data stored in ACNUC9435 zone)

EMBL: CP002400.PE109

CP002400.PE109       Location/Qualifiers
FT   CDS_pept        112231..113013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0110"
FT                   /product="papain cysteine protease family protein"
FT                   /note="KEGG: psp:PSPPH_2358 papain cysteine protease family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25700"
FT                   /db_xref="GOA:E6U621"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6U621"
FT                   /inference="similar to AA sequence:KEGG:PSPPH_2358"
FT                   /protein_id="ADU25700.1"
FT                   /translation="MRHKYLLRPDAPDARDYRFSALAPVPVLHDTDYTAKFPPVWDQGQ
FT                   LSSCQSHAIDAIDAYVKGYAFTPSHLFEYYNVRALMGTVSEDSGGDLRTTCQALSNNGV
FT                   CDAAVWPYNISRFADKPPQVAYDNANLDNDKIYTYYRVSGIDQIRQALSAGHTPLIGIR
FT                   IYENFESQTTLQSGIIPAPGGALLGGHALVIVAHHDEPSTGCKAKDFMGHVVLRHSAGF
FT                   FKIRNSWGTGIGLNGSGYFTATYEVLEKLLMDTWVIVQ"
     atgcgacaca aatatctgct ccgcccggat gcgccggatg cgcgcgacta tcgtttttcc        60
     gcgctggccc cggtgcccgt tttgcacgac accgactaca ccgccaaatt tcctcccgtt       120
     tgggatcagg gacagctcag cagctgccag agccatgcca tcgacgccat cgacgcgtat       180
     gtcaagggat atgcgttcac gccgtcccac ctgtttgaat actacaacgt gcgcgcgctg       240
     atgggcaccg tgagcgagga ctccggcggc gacctgcgca ccacctgtca ggcattatcc       300
     aacaacggcg tgtgcgacgc ggctgtctgg ccgtataaca tctcccgatt tgccgacaaa       360
     cccccgcagg tcgcttatga caacgccaat ctggacaacg acaaaatcta tacctactac       420
     cgcgtatccg gcatcgatca gatccggcag gcgctttccg ccgggcacac gccgctcatc       480
     ggcatccgaa tatacgaaaa ctttgaatcc cagaccacac tgcaaagcgg catcatcccc       540
     gcgccgggcg gcgcgctgct gggcggacac gcgctggtga ttgtcgccca tcatgacgag       600
     ccgtccacag gttgcaaggc caaggatttt atgggccatg tggttctgcg ccacagcgcc       660
     ggatttttca aaattcgcaa cagctggggt accggcatcg gcttgaacgg ttccggctat       720
     ttcacggcca cctatgaggt gctggaaaag ctgctgatgg atacgtgggt aatcgtacag       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page