(data stored in ACNUC9435 zone)

EMBL: CP002400.PE111

CP002400.PE111       Location/Qualifiers
FT   CDS_pept        complement(114816..115244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mla:Mlab_1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25702"
FT                   /db_xref="UniProtKB/TrEMBL:E6U623"
FT                   /inference="similar to AA sequence:KEGG:Mlab_1106"
FT                   /protein_id="ADU25702.1"
FT                   /translation="MKTSHFFTKIAAISGTILVWIPVLFTVITSVIGTLTSGRLRFDFL
FT                   MPAELFPFALGGAILLVFTALRTRFYRKYVVIGFTLAILCLFGGQGIAVVSGLASGAIA
FT                   PAGLVWAAVVVSIVIYSLSVVELGIVGILIALKLYRSK"
     atgaaaacct cgcatttctt cacaaagatt gccgccatat ccgggacgat cctcgtttgg        60
     attccggttt tgtttacggt catcacatcc gtgatcggca cgctgaccag cgggaggctg       120
     cgatttgact ttctgatgcc ggcagagctg tttccgtttg ctttgggcgg cgccattctg       180
     ctcgtattta cggcgctgcg gacacgtttt tatcgaaaat acgtggtcat tggctttact       240
     cttgcgattc tatgcctgtt tggcggccaa ggcatcgccg ttgtcagcgg gctggcatcg       300
     ggggccatcg cgcctgcggg gctggtttgg gcagcagttg tcgtttcgat cgttatctat       360
     tcgctgtcgg ttgtcgaact gggcatcgtg ggaatcctga tagccttaaa actatatcga       420
     tccaaataa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page