(data stored in ACNUC9435 zone)

EMBL: CP002400.PE114

CP002400.PE114       Location/Qualifiers
FT   CDS_pept        117635..118819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0116"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: clj:CLJU_c36050 putative
FT                   membrane-bound protein; SMART: GGDEF domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25705"
FT                   /db_xref="GOA:E6U626"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E6U626"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADU25705.1"
FT                   /translation="MASKEFKNDLILQNIQRGKLLAIVIIVFETVYLLIDVICSFQKIS
FT                   NTFSFYSYSIMYFMMISINLVYLFLTHCFTLKCIHTSATNALFTFYLTLIMAWGSVISL
FT                   MDQRLYGQLMSFMVNMIVCSIIYLMDAKMMRIPYLISIIILTVGLPFFQRSSNVLIGHY
FT                   VNLLVFVVISWMASRIVYRNYCDNYVIEKLMNQSKILLEKGMEENRIINRELAIANMQL
FT                   KKLTLMDELTELPNRRSFREFVDKTFQMHSTVSVIMIDIDYFKQYNDSYGHDAGDAALT
FT                   TVAKQIGSIVENTYQIAVRWGGEEFIYAAFNITKENIIEIANALRLRILNLKIPNRNSL
FT                   ACPYITISLGICTGTVANIKNFDSIIKIADQALYQAKNNGRNRVTILDYEEETL"
     ttggcaagca aagagtttaa aaatgacctg atcctccaaa atattcaaag aggaaagttg        60
     ctggcaatcg ttatcatagt cttcgagact gtttatctgc taattgatgt catttgttct       120
     tttcagaaaa tcagcaatac attttccttt tattcgtatt ccatcatgta ttttatgatg       180
     atttccatca acttggtgta tttgtttttg acccactgtt ttactctgaa atgtattcat       240
     acaagcgcga ccaatgctct atttacattt tatttgaccc tgattatggc ctggggaagc       300
     gttatctctc tgatggatca gcgattatat ggccagctaa tgtcttttat ggtcaacatg       360
     atcgtatgct ctatcattta tttgatggac gcaaaaatga tgagaatccc ttatttgatt       420
     tctataatca ttctcacggt tggtctgccg ttttttcaga gatcaagcaa tgtgctgatc       480
     ggtcattacg taaatctgct tgtttttgtt gtcatatctt ggatggcatc gagaattgta       540
     taccgcaatt actgcgataa ctatgtcatc gaaaaactca tgaatcagtc gaaaatacta       600
     ctcgaaaagg gaatggaaga aaacaggatc attaatagag agcttgctat cgcgaacatg       660
     cagttgaaaa aacttacgct tatggacgag ttgacggagc ttccaaatcg cagaagtttt       720
     cgtgagtttg ttgataagac gtttcaaatg cattctactg tatctgtcat catgatagat       780
     attgactact tcaagcagta taacgattcc tacgggcatg acgcgggaga tgcagcattg       840
     actacggtgg caaaacagat cggttccata gtcgaaaaca cataccaaat cgccgttcgc       900
     tggggcggtg aggaatttat ctatgcggct ttcaatataa ccaaagaaaa cattatcgag       960
     attgccaatg cgctccgatt gagaatttta aatctcaaaa ttccaaaccg gaattccctt      1020
     gcttgtcctt atatcaccat tagcttgggt atctgcactg ggactgtagc aaacataaaa      1080
     aattttgaca gtataattaa aattgctgac caagctctat atcaagcaaa aaataacggt      1140
     cggaatcgcg tcactatctt ggactatgag gaggaaactt tatga                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page