(data stored in ACNUC9435 zone)

EMBL: CP002400.PE12

CP002400.PE12        Location/Qualifiers
FT   CDS_pept        11698..13104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0012"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="KEGG: cby:CLM_0752 drug resistance transporter,
FT                   EmrB/QacA family; TIGRFAM: drug resistance transporter,
FT                   EmrB/QacA subfamily; PFAM: major facilitator superfamily
FT                   MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25603"
FT                   /db_xref="GOA:E6U5D6"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D6"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADU25603.1"
FT                   /translation="MELSKTRKNLILAVSCVEAFMATLDGSIVNIALPDISKQMRVEIS
FT                   AVQWVSTAYLLAIVLLLLLWGKLADLRGKKGVIITGFLFFAAGSALCSFSKSLEFLIIA
FT                   RIIQAVGAGAMMSLSQGIVTSTFAPGERGSALGQVGMMVALGSLAGPFLGGILVSAFGW
FT                   PSIFIINVPIAVASAVLAFCVLPSHMENPEKQTFDWRGAVLFSAGILVLFLTLLLAQQG
FT                   SISSIWLLPAVAVAAAALFGFIYTERRVPDPLVHLGLFRKQPFSLGLLQGYLIFIALSA
FT                   TLLFIPFYLQDLLRYDAFHAGLIVAVYPIVLAFVSPLSGRLADRMSTRPLTASGTGISA
FT                   AALFVLAFVRQDTPMWVIIVALAALGVGNGLFQSPNNSDIFNTVPPAQLGIAGGINALF
FT                   RNLGFVSGTAFSVLIFSFTAGLNVNSISGTMDAHAFMRGFSPVFLFCGACAAAALALCF
FT                   VRIAKRTRTA"
     ttggaattat cgaaaacaag aaaaaatctg attctggcgg tgtcctgcgt ggaagcgttc        60
     atggccacgc tggacggcag catcgtcaac atcgcgctgc cggatatttc caaacagatg       120
     cgtgtggaaa tcagtgcggt gcagtgggtc agcaccgctt atctgttggc cattgtgctg       180
     ctgttgcttt tgtggggcaa gctggccgac ctgcgcggaa aaaaaggcgt catcatcacg       240
     ggttttctgt tttttgccgc gggttccgcg ctgtgcagtt tctccaaatc actggaattt       300
     ctcatcattg cccgcattat ccaggcggtg ggcgcgggcg ccatgatgtc gctcagccag       360
     gggatcgtca ccagcacatt tgcgccgggc gaacgcggca gcgcgcttgg gcaggtgggc       420
     atgatggtgg cgctgggcag tctggccggc ccgtttctgg gcggcattct ggtcagtgca       480
     ttcggctggc cgtctatttt catcatcaac gtgcctattg cggtggcgtc ggccgtgctg       540
     gcgttctgcg tgcttccttc tcatatggag aatccggaaa aacagacatt cgactggagg       600
     ggcgccgttc ttttttctgc gggtatcctg gtgctgtttt tgacgttgct gttggcccaa       660
     cagggcagca tctcgtccat ttggctgctg cccgcggtgg cggtggccgc cgcggcgctt       720
     tttggtttca tctatacgga gcggcgcgtc cccgacccgc tggtgcatct ggggcttttc       780
     cggaagcagc cgttcagtct gggattgctg cagggttatc tgatcttcat cgctctgagc       840
     gccacgctgc tgtttatccc attttatttg caggacctgt tgcggtatga cgctttccac       900
     gccggattga tcgttgccgt ctaccctatc gtgctggcat ttgtatcccc gctcagcggg       960
     cggttggcgg accgtatgtc cacccggccg ctcactgctt cgggcaccgg catttcggct      1020
     gccgccctgt tcgttctcgc gttcgtccgg caggatacgc cgatgtgggt catcatagtg      1080
     gccctggctg cgctcggcgt gggtaacggg ctgttccagt cgcccaacaa ttcggatatt      1140
     ttcaatacgg tgccgcctgc ccagctcggc atcgccggcg gcatcaacgc gttgtttcgc      1200
     aatctggggt ttgtgtccgg cacggccttc tcggttctca ttttttcatt caccgccggt      1260
     ctgaatgtca attccatctc cgggacaatg gatgcgcatg ccttcatgcg cggtttttcc      1320
     ccggtatttt tattctgcgg ggcctgtgcg gccgcggcac tggcgctttg cttcgtccgc      1380
     attgcgaaac gcacacggac ggcgtga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page