(data stored in ACNUC9435 zone)

EMBL: CP002400.PE121

CP002400.PE121       Location/Qualifiers
FT   CDS_pept        130553..131230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0125"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="KEGG: ere:EUBREC_1222 putative transcriptional
FT                   regulator; PFAM: cyclic nucleotide-binding; regulatory
FT                   protein Crp; SMART: regulatory protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25712"
FT                   /db_xref="GOA:E6U633"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6U633"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADU25712.1"
FT                   /translation="MLYPHDMEFLAQHLPFLARLSENDRRLIAAAGLKSSFEKGETILS
FT                   REKECNGLIVVESGQLRAFFELEDGKELTLYRLLAGDICILSASCVLKNITFEVTLEVE
FT                   KAGSVYFIPAALLGSLSERESAVKQFTMELVSERFSEVMWVMEQMVTKNMGQRVAAFLL
FT                   EQTNLEGSQILTITHDTIAKNLGTAREVVSRVLKYMENDGVIELSRGKITITQAKKLQE
FT                   ISH"
     atgctatacc cccatgacat ggaattttta gcgcagcatc tgccttttct ggcgcgtctg        60
     agcgaaaacg accgccgttt gattgctgcg gcgggtttga agtcttcctt tgagaagggg       120
     gagaccatcc tcagccgtga aaaagagtgc aacgggctga ttgtagttga aagcggccag       180
     ttacgcgcct tttttgagct ggaagacggt aaggaactga cgctttaccg gctgcttgca       240
     ggcgacatct gcattctgag cgcttcctgt gtcctgaaaa acatcacctt cgaggtgaca       300
     ctggaagtgg aaaaagccgg cagcgtatat ttcatcccgg ccgccctgtt gggcagcctc       360
     tccgagcggg agagcgcggt caagcagttt acgatggaac tggtttccga gcgcttttcc       420
     gaagtgatgt gggtgatgga gcagatggtc accaaaaaca tgggccagcg cgtggccgcc       480
     ttcctgctgg agcaaaccaa tctggaaggc tcgcagatcc tgaccatcac ccatgacacc       540
     attgcaaaaa acctgggaac ggcccgcgag gtcgttagcc gggtactcaa atatatggaa       600
     aatgacggcg tgattgaact ttctcgcggg aagatcacca tcacgcaggc aaaaaaactg       660
     caggagataa gccactga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page