(data stored in ACNUC9435 zone)

EMBL: CP002400.PE122

CP002400.PE122       Location/Qualifiers
FT   CDS_pept        complement(131356..131679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0126"
FT                   /product="thioredoxin"
FT                   /note="KEGG: saf:SULAZ_0121 thioredoxin; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25713"
FT                   /db_xref="GOA:E6U634"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E6U634"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADU25713.1"
FT                   /translation="MSAISLNRSNFEDVVLNTDKPVLIDFWASWCGPCRMQSPVIEELA
FT                   EKLEGAAVVAKLNVDENPELAAQFSVMSIPTLVFVKDGRIVGRRTGVTSGAELLSILRT
FT                   VSV"
     atgtctgcca tctcattgaa ccgcagcaat tttgaagatg tggtcctgaa caccgacaaa        60
     ccggtgctga ttgatttctg ggcatcctgg tgcgggccct gccggatgca gtctcccgtc       120
     attgaagaac tcgcggagaa actcgaaggt gccgcagttg ttgcgaaact gaacgtggat       180
     gaaaaccccg agcttgccgc gcagttttcg gtcatgagca tccccacgct cgtgtttgtc       240
     aaggacggaa ggatcgtggg gcgcagaacc ggggtgacat ccggagccga gctgctctcc       300
     attctccgca cggtcagcgt ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page