(data stored in ACNUC9435 zone)

EMBL: CP002400.PE123

CP002400.PE123       Location/Qualifiers
FT   CDS_pept        131803..132378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0127"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: hmo:HM1_1722
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25714"
FT                   /db_xref="GOA:E6U635"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E6U635"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADU25714.1"
FT                   /translation="MAHKFDPSHLKKLDSEERRNLLSPAQTLVALGFSPDQTLADIGCG
FT                   TGLFTLPAAEINRGKGTVYAVDIAREMLDEIGKRAAAAGLSNITTVQADEYGTNLPDAA
FT                   ADFLLVCTVLHEVDDKVRWLQEAARICRKGGSIAVIEFDPSFTGFGPPAAHRLPKDRTM
FT                   EALRAAGFTPVQEINLHGAFYVIKAARK"
     atggcgcaca aattcgatcc ttcccatctg aaaaaactgg attcggaaga acggcggaac        60
     cttttatccc cggcgcaaac gctggttgcg ctcggctttt cgcctgacca gaccttggcc       120
     gacatcggct gcggcaccgg tttgttcacg ctgccggcag ccgaaatcaa ccgcggaaaa       180
     ggtaccgttt acgcggttga catcgcgcgg gaaatgctcg acgagatcgg gaagcgcgcg       240
     gcggcggccg gcctttccaa cattaccacc gtgcaggcgg atgaatacgg aactaacctc       300
     ccggacgccg cggccgattt tctcttggtc tgtaccgtcc tgcatgaagt cgacgacaaa       360
     gtccgctggc tgcaggaagc cgcgcgcatc tgccggaaag gcggcagcat cgctgttatc       420
     gaattcgatc cgtctttcac cggtttcggt ccgccggcgg ctcacaggct gcccaaagac       480
     cggacgatgg aggccctgcg ggctgccggg ttcacgcccg tacaggaaat aaacctccac       540
     ggcgcgttct atgtgataaa agccgcccgg aaataa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page