(data stored in ACNUC9435 zone)

EMBL: CP002400.PE131

CP002400.PE131       Location/Qualifiers
FT   CDS_pept        142857..143432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0135"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="KEGG: cbl:CLK_2186 glutamine amidotransferase
FT                   subunit PdxT; TIGRFAM: SNO glutamine amidotransferase;
FT                   PFAM: SNO glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25722"
FT                   /db_xref="GOA:E6U643"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E6U643"
FT                   /inference="protein motif:TFAM:TIGR03800"
FT                   /protein_id="ADU25722.1"
FT                   /translation="MKTVGVLALQGSFREHLAMLAKLNDVTPLAVKNTDDLARVDGLIL
FT                   PGGESTAQGKLLRDFKLLEPLRVRIRDGLPVWGTCAGLILLAKQIEGGEPTHLGVMDIA
FT                   VRRNAYGGQLDSFTAAAVLPGISPEPFSLVFIRAPWIEQAGAGVEVLARYGEHIIAAKE
FT                   RNMLVTSFHPELTGDMRFHAYFVRQIAG"
     atgaaaaccg tcggcgtatt ggctttgcaa ggctcgttcc gcgagcacct ggcgatgctg        60
     gccaaactga acgatgtcac gcccctggcc gtaaagaaca cggacgacct cgcgcgggtg       120
     gacgggctga ttctgcccgg cggcgagagc accgcgcagg gcaagctgct gcgggatttt       180
     aagctgctgg aaccgctgcg ggtgcgcatc cgggacgggc tgcccgtctg gggcacctgc       240
     gcgggactga ttctgctggc caaacagatc gagggcggcg agccgactca tctgggcgtg       300
     atggacatcg ccgtgcggcg caacgcctac ggcgggcagc tcgacagctt caccgctgcc       360
     gccgtgctgc ccggtatctc gcccgaaccg ttctcgctgg tgtttatccg cgcgccgtgg       420
     atcgaacagg caggcgcggg agtggaggtg ctggcgaggt atggggagca tatcatcgcc       480
     gcgaaagaac gaaacatgct ggtcacctcg tttcacccgg aactgacagg tgacatgcgg       540
     ttccatgcgt attttgtccg gcagatcgcg ggataa                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page