(data stored in ACNUC9435 zone)

EMBL: CP002400.PE133

CP002400.PE133       Location/Qualifiers
FT   CDS_pept        complement(144312..145001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amd:AMED_1395 YVTN beta-propeller
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25724"
FT                   /db_xref="UniProtKB/TrEMBL:E6U645"
FT                   /inference="similar to AA sequence:KEGG:AMED_1395"
FT                   /protein_id="ADU25724.1"
FT                   /translation="MARLHAVRRRRRRGRSSAGMLGLVVVAAGAVMLVLAFAAAGGGGA
FT                   GAASGSTASAQASSAGAASALETYLAPLVAQDPKPFASLARADRDWMLKTAVWVAAEQD
FT                   HYAYTSDDRQSVPADRVRSAYRTFFGSDAAPSFRTFASDGVEYVYHADTQRYDVPVTAK
FT                   KDVYTPRVTAVRQDGDTLAVTVGYVPSTGWTQRADGSVVPPASVKTMRYTLRHDGTGYA
FT                   VSAVENA"
     atggcgcgtt tgcatgccgt ccgccgccgc aggcggcgcg ggcggagcag cgcgggcatg        60
     ctggggctgg tggtggtggc cgccggggcg gtcatgctgg tgctggcgtt tgccgccgcg       120
     ggcggaggcg gtgccggcgc cgcgtccggc agtacggcgt ccgcacaggc gtcgtcggcc       180
     ggagccgcct ccgctttgga aacgtacctc gcgcccctgg tggcgcagga ccccaaaccg       240
     tttgccagcc ttgcccgcgc ggatcgggac tggatgttga aaaccgcggt gtgggtcgcc       300
     gcggagcagg atcattacgc ctatacgtcg gacgaccggc agtccgtgcc ggccgaccgt       360
     gtgcggagcg cttaccgcac gtttttcggc agcgatgcgg cgccgtcgtt ccgcacgttt       420
     gcgtcggacg gtgtggagta tgtctaccac gccgatacac agcggtatga cgtaccggtg       480
     acggccaaaa aggatgttta cacgccccgc gtcaccgccg tgcggcaaga cggggacacc       540
     ctggccgtga cggtgggcta tgttcccagc acaggatgga cacaacgcgc cgacggttcc       600
     gtcgtgccgc ccgcgtcggt caagaccatg cggtatactc tgcggcacga cggcacgggt       660
     tatgccgttt cagccgtgga aaacgcgtga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page