(data stored in ACNUC9435 zone)

EMBL: CP002400.PE135

CP002400.PE135       Location/Qualifiers
FT   CDS_pept        complement(146253..147068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0139"
FT                   /product="glutamate 5-kinase"
FT                   /note="KEGG: cth:Cthe_1766 gamma-glutamyl kinase; TIGRFAM:
FT                   glutamate 5-kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25726"
FT                   /db_xref="GOA:E6U647"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:E6U647"
FT                   /inference="protein motif:TFAM:TIGR01027"
FT                   /protein_id="ADU25726.1"
FT                   /translation="MALQDAKRIVCKVGTSTLTYPNGRLHIRRIEKLVRVLSDFKNSGK
FT                   DVILVTSGAIGVGATRLGLDERPRDTRMMQAAAAVGQVELMYLYDKLFLSYGQVVAQIL
FT                   MTRILTDHDSTRQNLVNTFETLLSLGVIPVVNENDSVAVEELEEEAMAFGGNDTLSAVV
FT                   AVLVQADALVLLSDIEGLFDKNPREAPDACLIPVVESVDERVRASAGGAGSTLGTGGMV
FT                   TKLEAAEMVTKNGIDMVIMDGSDPEKLYALFDGKQVGTYFPANPKGERT"
     atggcgttgc aggacgcaaa acggatcgta tgcaaagtgg gcacttccac cctcacctac        60
     ccgaacggcc ggctgcatat ccggcgcatc gaaaaactgg tgcgggtgct gtccgatttc       120
     aaaaacagcg gcaaggatgt gattctggtc acctccgggg ccatcggcgt gggcgccacc       180
     cggctggggc tggacgagcg accgcgcgac acgcgcatga tgcaggccgc cgccgccgtg       240
     gggcaggtgg agctgatgta cctctacgac aaactgttcc tgtcctatgg gcaggtagtg       300
     gcgcagattc tcatgacccg catcctcacc gaccacgaca gcacccggca gaacctcgtc       360
     aacaccttcg aaaccctgct gtcgctcggc gtcatcccgg tggtgaacga gaacgactcg       420
     gtagcggtgg aagagcttga ggaagaagcc atggcgtttg gcggaaacga cacgctctcc       480
     gccgtggtgg ccgtgctggt gcaggccgac gcgctggtgc tgctgagcga catcgagggc       540
     ctgtttgaca aaaacccgcg cgaggcgccg gacgcctgcc tcatcccagt ggtggaatcg       600
     gtggatgaac gggtgcgcgc atcagcgggc ggcgcgggtt ccacgctggg caccggcggc       660
     atggtcacca agctggaagc cgccgagatg gtcacgaaga acggcatcga tatggtcatc       720
     atggacgggt ccgacccgga aaaactatac gcattgttcg acgggaaaca agtgggcacc       780
     tattttcccg caaacccaaa aggagaacgg acatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page