(data stored in ACNUC9435 zone)

EMBL: CP002400.PE137

CP002400.PE137       Location/Qualifiers
FT   CDS_pept        complement(149686..151134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0141"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="KEGG: dau:Daud_0163 thiamine biosynthesis protein
FT                   ThiH; PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25728"
FT                   /db_xref="GOA:E6U649"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:E6U649"
FT                   /inference="protein motif:PFAM:PF06968"
FT                   /protein_id="ADU25728.1"
FT                   /translation="MDYLKQYEDEMAAYDRQDHDFIDDDKIWSQLKAAENPSREAVRAV
FT                   LQKAEKTVRLEPEETAILLQNSDPETITEMYELANRLKQEVYGDRIVFFAPLYISDECA
FT                   NDCKYCGFRRSNHMMHRKTLSMDEIDKEVRTMIREGQKRTVLVYGEAPSTGIDFLCKSI
FT                   EKVYSVKEGNGEIRRANINAAPLSVPELRRLKEIGIGTFQVFQETYHHETYRHLHPANT
FT                   VKGNYRWRLYAMDRALEAGLGDVGIGALFGLYDWRFEVMGLLYHTIHLEETFNGVGPHT
FT                   ISFPRITPATGTPFSDHPEYAVSDEDFKKLVAVLRLSVPYTGMICTARETKEVRDSVLP
FT                   LGVSQIDGGTRIGVGGYGVKDANALPDKEQFSLGDTRSLDDVVLETGEMGNIPSFCTAC
FT                   YRMGRVGEEFMGLAKSKFVHHFCIPNAIFTFKEYLLDYAGPETREKGEQIIAKHVARFA
FT                   GEPIYDTIRENLRRLENGERDLRV"
     atggattatc tgaaacagta tgaagacgaa atggccgcct atgaccggca ggaccatgat        60
     tttatagacg acgataagat ttggagccag ctcaaggcgg cggagaaccc gtccagagag       120
     gcggtacgcg cggtgctcca aaaggcggag aagaccgtcc ggctcgaacc ggaagaaacg       180
     gccatccttc tccagaacag cgacccggaa acaatcaccg aaatgtacga gttggccaac       240
     cggctcaagc aggaggtcta cggcgaccgc atcgtcttct tcgcgccgct ctatatcagc       300
     gacgaatgcg ccaacgactg caaatactgc gggttccgcc gcagcaatca catgatgcac       360
     cgcaagaccc tctcgatgga cgaaatcgac aaagaggtgc gcaccatgat ccgcgagggc       420
     cagaaacgca ctgtgctggt ctatggcgaa gcgccgtcca ccggcatcga cttcctctgc       480
     aagtccatcg aaaaggtcta tagcgtcaag gagggcaacg gcgagatccg ccgcgccaac       540
     atcaacgccg cgccactttc ggtgccggag ctacgccgtc tcaaagaaat cggcatcggc       600
     accttccagg ttttccagga aacctatcac cacgagacct accggcatct gcatccggcc       660
     aacaccgtca aaggcaacta ccgctggcgg ctctacgcga tggaccgcgc actggaagcc       720
     ggtctgggcg acgtgggcat cggcgcgctg ttcgggctgt acgactggcg gttcgaggtg       780
     atgggcctgc tttaccacac catccatctg gaggagacgt tcaacggcgt ggggccgcac       840
     accatttcgt tcccgcgcat cacgcccgcg accggcacgc cgttctccga ccaccccgaa       900
     tacgcggtaa gtgacgagga tttcaaaaag ctggtggccg tcctgcggct gtcggtgcca       960
     tataccggca tgatctgcac cgcgcgtgag accaaagagg tgcgcgattc ggtgctgccg      1020
     ctgggcgtgt cccagatcga cggcggcacg cgcatcggcg tgggcggcta tggcgtgaaa      1080
     gacgccaacg ccctgccgga caaggagcag ttttcgctgg gcgatacccg ctcgctggat      1140
     gatgtggtcc tggaaaccgg ggagatgggc aacatcccct cgttctgcac ggcctgctat      1200
     cgcatggggc gcgtgggcga ggagttcatg gggttggcca agtccaaatt cgtgcaccat      1260
     ttctgtattc ccaacgccat cttcacgttc aaggaatacc tgctcgacta cgccggcccg      1320
     gaaacgcgcg aaaagggcga gcagatcatt gccaaacacg ttgcgcgctt tgcgggcgaa      1380
     ccgatctacg acaccattcg ggaaaacctg cgccgcttgg aaaacgggga gcgcgatctg      1440
     cgcgtctga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page