(data stored in ACNUC9435 zone)

EMBL: CP002400.PE14

CP002400.PE14        Location/Qualifiers
FT   CDS_pept        13951..15237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0014"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="KEGG: gsu:GSU1272 dihydroorotase, multifunctional
FT                   complex type; TIGRFAM: dihydroorotase, multifunctional
FT                   complex type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25605"
FT                   /db_xref="GOA:E6U5D8"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5D8"
FT                   /inference="protein motif:TFAM:TIGR00857"
FT                   /protein_id="ADU25605.1"
FT                   /translation="MNGLLLIKGATLVDPEEVYAGVGDLLVKDGKIAAVAESGGNLAAP
FT                   AGTTVLDARGLYLSPGLVDMHVHLRDPGQTHKETIETGCAAAAAGGVTALAAMPNTSPA
FT                   ADTPAVLVYEAAQAEPTGVRVFPIAAVSKAQAGDELTDFEMLSEAGAVAFSDDGHPVRD
FT                   AAQMLEAMRRAHALGKRVISHCEDESLADAGIVSDTAAKRLDVPGIPAATEAVHAAREA
FT                   VLAESTGTPVHIAHVSSRFTVALLRDAKRRGAPVTCETCPHYFSLDDSLLDARDADYRM
FT                   NPPLREKADVAAVIKGLRDGTIDAIVTDHAPHTAGEKADFTAAPNGVVGLETSLAAGIT
FT                   YLVRPGHLSLPQLIRKMTTVPADLLGIRAGRLKIGTRADMVLFDPAAPWTVRPEALHSK
FT                   SHNTPYKGMTLYGEVRYTISDGCIIFSKT"
     atgaacgggc tgttgctgat caaaggcgcg acgctggtag acccggagga ggtctatgca        60
     ggcgtgggcg atctgctggt gaaagacggc aaaattgccg cggtcgccga atcgggcggt       120
     aacctggcgg ctcctgcggg caccacggtg ctggatgcgc gcgggctcta tctttccccc       180
     ggattggtag acatgcatgt ccatctgcgc gatcccgggc agacgcacaa ggagaccatc       240
     gaaaccggct gcgcggctgc ggccgccggg ggcgtcaccg cgctggccgc catgccaaac       300
     acatcccccg cggccgacac cccggcggtg ctcgtttatg aggccgcgca ggcggaacct       360
     accggcgtgc gggtgtttcc catcgcggcg gtgagcaagg cgcaggcggg cgatgaactg       420
     accgattttg agatgctgtc ggaagcgggc gcggtggcgt tttcggacga cggccacccc       480
     gtgcgggacg cggcgcagat gctggaagcc atgcggcggg cccacgcgct gggcaagcgg       540
     gtgatctccc actgcgagga tgaaagcctt gcggacgcgg gcattgtcag cgatacggcg       600
     gcaaagcgac tggatgtgcc cggtatcccg gccgcgactg aggcggtgca cgccgcaaga       660
     gaggcggtgc tggcggaaag caccggcacg cccgtgcata tcgcgcatgt gagcagccga       720
     ttcaccgtcg cgctgctgcg cgacgccaag cggcggggcg cgccggtcac ctgtgagacc       780
     tgcccgcatt atttcagcct ggacgacagc ctgctggacg cgcgagatgc ggattaccgc       840
     atgaatcctc cgctgcggga aaaagcggat gtggccgccg tgatcaaagg gctgcgggat       900
     ggtaccatcg acgccatcgt gaccgaccac gcgccgcata ccgcgggaga aaaagccgac       960
     tttaccgcgg cgcccaacgg cgtggtgggg ctggaaacgt cgcttgcggc aggtatcacc      1020
     tatttggtgc ggccggggca cctttccctg ccccaactga tccggaaaat gaccaccgtg      1080
     ccggcggacc tgctgggaat ccgtgcgggg cggctgaaaa tcggcacgcg cgcggatatg      1140
     gtgctcttcg accccgccgc gccgtggacg gtgcggcccg aagcgctgca cagcaaatcg      1200
     cacaacacac cgtataaagg tatgacactc tatggcgagg tgcgttacac catttcggac      1260
     ggatgcatca tcttttccaa aacatga                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page