(data stored in ACNUC9435 zone)

EMBL: CP002400.PE147

CP002400.PE147       Location/Qualifiers
FT   CDS_pept        complement(160555..161247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0151"
FT                   /product="dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /note="KEGG: cbt:CLH_3041 dihydrodipicolinate
FT                   synthase/N-acetylneuraminate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25738"
FT                   /db_xref="GOA:E6U659"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6U659"
FT                   /inference="similar to AA sequence:KEGG:CLH_3041"
FT                   /protein_id="ADU25738.1"
FT                   /translation="MEPFIPEFEGNLRRHMLKVPESIRQASGIKIFGKLLKSFVFTTDV
FT                   SVIRNVNADAVIAVYPFTPQPIITQAIMLSADIPVFCGIGGGITMGKRVINNALNAEFQ
FT                   GAMGVVVNAPTANDIIALLCETVDLPVVVTVVSDEDISSRVEAGASIINVSGGPHTADI
FT                   VASIRSQYPKLPIIATGGPTDESISKTIRAGANAVTWTPPSSAEILAGIMRRYRTHPED
FT                   LQSRRLEN"
     atggagcctt ttattcctga atttgaaggg aatctgcgca gacatatgct caaggtgccg        60
     gaaagcatcc ggcaggcttc gggcattaag atttttggca agctgctcaa atcgtttgtt       120
     tttaccaccg atgtgtctgt gatccgcaac gtgaacgccg atgccgtgat cgccgtctat       180
     ccgttcaccc cgcagccgat catcacgcag gccatcatgc tctcggccga tatcccggtg       240
     ttctgtggca tcggcggcgg catcaccatg ggcaaacgcg tcatcaacaa cgcgctcaat       300
     gcggaatttc agggcgccat gggcgtggtg gtcaacgcgc ccaccgccaa cgacatcatt       360
     gctctgcttt gcgaaacggt ggacctgccg gtggtggtca cggtcgtttc agatgaggac       420
     atctccagcc gcgtggaggc cggcgcctcc atcatcaacg tctcgggcgg cccgcacacg       480
     gcggacatcg tcgcatccat ccgcagccag tatcccaaat tgccgatcat tgccaccggc       540
     ggccccacgg atgaaagcat ctccaaaacc attcgcgccg gcgccaacgc cgtcacctgg       600
     acaccgccgt ccagcgcgga gattctcgcg ggcatcatgc ggcgctaccg tacgcatccc       660
     gaagacctgc agagccggcg tctggaaaat taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page