(data stored in ACNUC9435 zone)

EMBL: CP002400.PE151

CP002400.PE151       Location/Qualifiers
FT   CDS_pept        complement(166046..166519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0155"
FT                   /product="transcription elongation factor GreA"
FT                   /note="KEGG: cth:Cthe_2897 transcription elongation factor
FT                   GreA; TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25742"
FT                   /db_xref="GOA:E6U6K9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6K9"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ADU25742.1"
FT                   /translation="MAKQYVLTDAGLKKLEQELEQLKTEKRKEIAEKIKVALSFGDLSE
FT                   NSEYDEAKNEQAMVESRIATIEAMLKNVKLIDDDQLDTEAVNLGSKVQVFDVEFDETVE
FT                   YQIVGSTEADPDQNLISDESPVGRALLGHKVGDEVEAETPAGVLKFKVLNITK"
     atggccaaac agtatgtatt gacagatgcg ggtctgaaaa aactggagca ggagcttgaa        60
     cagctcaaaa ccgaaaagcg caaggagatc gccgaaaaga tcaaagtggc gctctcgttc       120
     ggtgaccttt cggaaaacag cgagtatgac gaagccaaaa acgagcaggc tatggtggaa       180
     tcgcgcatcg ccaccatcga ggccatgctc aaaaacgtca agctcattga cgacgaccag       240
     ttggacaccg aggcggtgaa cctcggctcc aaagtgcagg tcttcgatgt ggaattcgac       300
     gaaaccgtgg aatatcagat cgtcgggtcc accgaggcgg acccggacca gaacctgatt       360
     tccgacgagt cgccggtggg gcgcgcgctg cttggccata aggtgggcga tgaagtggaa       420
     gcggagaccc cggccggcgt gctgaaattc aaggtgctga atatcaccaa ataa             474
//

If you have problems or comments...

PBIL Back to PBIL home page