(data stored in ACNUC9435 zone)

EMBL: CP002400.PE152

CP002400.PE152       Location/Qualifiers
FT   CDS_pept        complement(166889..167773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0156"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ctc:CTC02509 cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25743"
FT                   /db_xref="GOA:E6U6L0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L0"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU25743.1"
FT                   /translation="MIEKIRYFVREGFKNIWVNRIMSIASICILTICLLLLGTSVLISI
FT                   NVHNLMNSVEQQNQIGVFLKDDADQAAIDQIGQDLRKLPDVAKVEFVSKAQALENEKKQ
FT                   LGKDQDLLSGVDKDNFFPNSYKVTLSNMQHYNLVVQKIHALPHIESVNEHSGVAEKLNS
FT                   ISSTVGWVGFWLFVLLAAVSLFIIVYTIKLAVYVRRREVNIMKFVGATDWFIRWPFFVE
FT                   GLLIGLLSGVIGSILQWYLYGGLIKRLFSSLRIIHPIAYSSVGVLLSLGFILSGILLGV
FT                   VGSLISVHRYLRV"
     atgatagaga aaatacggta tttcgtccgc gaaggtttca aaaatatctg ggtcaaccgc        60
     atcatgtcca ttgcgtcgat ctgcatactg accatctgcc tgctgctgct cggcacgtcc       120
     gtgctgatct ccatcaatgt gcacaacctg atgaacagtg tggaacagca gaaccagatc       180
     ggggtcttcc tgaaagacga tgcggatcag gccgcgatcg accagatcgg ccaggatctc       240
     agaaaattac ccgatgtggc caaggtggaa tttgtttcca aagcgcaggc gctggaaaac       300
     gagaaaaagc agctcggcaa agaccaagat ctgctcagcg gggtggataa agacaatttc       360
     ttccccaact cctacaaggt gacgctcagc aacatgcagc actataacct ggtggtgcag       420
     aaaatccacg ctttgccgca catcgaaagc gttaacgagc attccggcgt ggcggaaaag       480
     ctcaacagca tcagcagcac cgtgggctgg gtgggattct ggctgttcgt gctgctggcg       540
     gccgtctcgc tgtttatcat cgtctacacc atcaagctgg cggtttacgt tcgccgccgg       600
     gaagtcaaca tcatgaagtt cgtcggcgcc accgactggt tcatccgctg gccgttcttc       660
     gtggaagggc tgctcatcgg cctgctttcg ggcgtgatcg gctccatcct gcaatggtat       720
     ttatacggcg ggctgatcaa gcggctgttc agttctctgc gcatcatcca ccccatcgcg       780
     tacagttccg tgggcgtgct gctttcactg ggctttatcc tttccggtat ccttctcggc       840
     gtggtgggca gtctgatttc cgtacataga tatctgcgcg tgtga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page