(data stored in ACNUC9435 zone)

EMBL: CP002400.PE157

CP002400.PE157       Location/Qualifiers
FT   CDS_pept        complement(171601..171957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rer:RER_13060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25748"
FT                   /db_xref="GOA:E6U6L5"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L5"
FT                   /inference="similar to AA sequence:KEGG:RER_13060"
FT                   /protein_id="ADU25748.1"
FT                   /translation="MNRMVLESWAIVIIMGVAAYMFGRARRKAWSFRVLPLILAPLANI
FT                   VYTPFAKELADRGSDAGAVRILVYIAAFAVTAVWVVFCARKLSPRVAKWGYISCTLAFT
FT                   AIELIIFAVKLIRF"
     gtgaaccgca tggtgcttga aagctgggcc atcgtgatta ttatgggcgt ggccgcctat        60
     atgtttgggc gcgcgcgccg caaggcgtgg tctttccgcg tgctgcccct cattctcgcg       120
     ccgcttgcca acatcgttta taccccgttt gccaaagagc tggcagaccg cgggagcgat       180
     gccggcgcgg tgcgcattct ggtttatatt gccgcatttg cggtcaccgc cgtctgggtg       240
     gttttctgcg cacgcaagct ctcgccccgc gtggcgaaat ggggatatat ctcctgcacg       300
     ctggcgttca ccgccatcga actcattatt ttcgcggtga agctcattcg gttctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page