(data stored in ACNUC9435 zone)

EMBL: CP002400.PE159

CP002400.PE159       Location/Qualifiers
FT   CDS_pept        172731..173810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0163"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mla:Mlab_1187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25750"
FT                   /db_xref="GOA:E6U6L7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6L7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25750.1"
FT                   /translation="MELTAYLNKNIDYLFRRALSAAMRNPRESTFLLRQAHRQARAAAK
FT                   RRRSEQTGQAVPAFLIASVASACNLRCAGCYARADGACNTEEACLLPAARWAELFEEAA
FT                   AMGISFILLAGGEPLTRVDVLEAAARVPSAVFPVLTNGTLFDAAVLRLFDRHRNLVPVC
FT                   SIEGGQTETDARRGAGVYHLLEQTWRAFRARGILFGVSVTVTAENHLRVTEAAFLGGLR
FT                   AKGCGVVLFVEYVPADANASLHPPDDAQRAAYSARLLTLQTVYPDLILIAFPGDEAKTG
FT                   GCLAAGRGFFHISASGGAEPCPFAPVSDVDLHTGSLADALRSPLFCALRENGMLAMAHD
FT                   GGCALFGKKAELESLAGTE"
     atggaactga ccgcctacct gaataaaaac atcgactatc tgttccgccg cgcgctgtcg        60
     gctgcgatgc gcaacccccg tgaaagcacc ttcctgctcc gccaggcgca ccggcaggca       120
     cgggcggccg caaaacgccg tcgcagcgag cagacgggcc aggccgttcc cgcgtttctc       180
     attgccagcg tggcctccgc ctgcaacctg cgctgcgcgg gatgctatgc gcgagcggac       240
     ggcgcctgta acacggagga agcttgcctg ctcccggccg cgcgctgggc ggagttgttt       300
     gaggaagccg ccgcgatggg catttccttc atcctgcttg cgggcggcga gccgctcacc       360
     cgcgtggacg tactggaggc cgccgcccgc gtgccttccg ccgtcttccc ggtgctgacc       420
     aacggtacgc tgtttgatgc ggccgtgctg cgcctgttcg accggcaccg caacctggtg       480
     ccggtctgca gcatcgaagg cgggcaaacg gaaaccgatg cgcggcgcgg cgcgggcgtc       540
     taccatctgc tcgaacagac atggcgcgcg ttccgggcgc gcggcatcct gttcggcgtg       600
     tccgtcacgg tgacggcgga aaaccatctg cgggtcaccg aagccgcgtt tctcggaggc       660
     ctgcgtgcaa aaggctgcgg ggtggtcctt tttgtggagt atgtccccgc cgacgcaaac       720
     gcctcgctgc atccgccgga cgacgcgcag cgcgcggcat acagcgcccg gctgcttacg       780
     cttcagacgg tatatcccga cctcatcctg atcgcgtttc ccggtgacga ggcaaaaacc       840
     ggcggctgcc tggcggcggg gcgcggattt ttccatatca gcgcgtcggg cggcgcggaa       900
     ccgtgcccgt tcgcaccggt ctcggacgtg gacctgcaca ccggctctct cgcggacgcg       960
     ctgcgctcgc cgctgttttg cgccctgcgg gaaaacggca tgctggccat ggcgcatgac      1020
     ggcggctgcg cgctctttgg gaaaaaagcg gagctggaat cgctggcggg aaccgaatag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page