(data stored in ACNUC9435 zone)

EMBL: CP002400.PE163

CP002400.PE163       Location/Qualifiers
FT   CDS_pept        176606..177127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0167"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: cdl:CDR20291_2264
FT                   NUDIX-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25754"
FT                   /db_xref="GOA:E6U6M1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADU25754.1"
FT                   /translation="MEWMDLRDGTGRPTGRLVPREHALQNGEFMLAVHVFIYRDDGRFL
FT                   LQKRSLRKRLYPGKWDITGGGVRAGESSLEAACREVEEEVGLTLPPRRMQKLARLKRPP
FT                   CFFDVWACRHAFEMDELVLQAEEVDAVRLVTPQEMLTVLFEEEYPDGGYRRVLADFLAN
FT                   AADAPLFRNG"
     atggaatgga tggatctccg cgacgggaca ggcaggccca ccggccgctt ggtaccacgc        60
     gaacatgcgc tgcaaaacgg tgagttcatg ctggcggtgc atgttttcat ctaccgcgac       120
     gacggccgct tcctgttgca gaaacgctcc ttgcggaagc gtctgtatcc cggcaaatgg       180
     gacattacgg gcggcggcgt gcgggcgggg gaaagcagcc tggaagccgc ctgccgggag       240
     gtcgaagagg aagtggggct cacgcttccg cccagacgga tgcagaagct ggccaggctc       300
     aagcggccac cctgcttttt cgatgtgtgg gcctgccgcc acgcgttcga gatggacgaa       360
     ctggtgcttc aggccgagga agtggatgcg gtgcgtctgg tgacaccgca ggagatgctc       420
     accgtcctgt tcgaagaaga atacccggac ggcggctacc gccgtgtcct cgccgatttt       480
     ctggccaacg ccgcggacgc gccgctgttt cgaaacggct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page