(data stored in ACNUC9435 zone)

EMBL: CP002400.PE165

CP002400.PE165       Location/Qualifiers
FT   CDS_pept        complement(177866..178477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0169"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cbk:CLL_A1977
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25756"
FT                   /db_xref="GOA:E6U6M3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADU25756.1"
FT                   /translation="MNKVTNRRGHAAQTQQDIFRVALELFRTTGYELTTIQDICEKANV
FT                   SVGAFYYYYKSKEDVLNDSYRQIDYTLNEKYAHVQFEDPVCGITEILCSLAGYVQEQGF
FT                   RIPAQIYKKQITATDRFMLDPNREYCILVSRLVAQACAGGRFSADYSEQTVTETILRMM
FT                   RGILYDWCLHDGSYDLVQQARADMRIILHHFEQANDLQPA"
     atgaacaaag ttacaaaccg gcgggggcac gccgctcaga cccaacagga tatttttcgt        60
     gtggctttgg agctttttcg tacaaccgga tatgaattga ccacgatcca ggatatttgt       120
     gaaaaggcca acgtttccgt tggcgcattc tattattatt ataaatcgaa agaggatgtt       180
     ctgaacgatt cttaccggca gatcgactat acgctgaatg agaaatatgc gcatgtacag       240
     ttcgaggatc ctgtctgcgg catcacggag attttatgca gtctggcagg ctacgtgcag       300
     gagcaggggt tccgcatccc ggcccagatc tataaaaagc agattaccgc aacagaccgg       360
     ttcatgctgg accccaaccg ggagtactgc attctggtca gccgtctggt cgcacaggcc       420
     tgcgcaggcg ggcgcttttc agcggattat tccgagcaaa cggtcacgga aacgattttg       480
     cgcatgatgc gcggcatcct gtacgactgg tgcctgcatg acggatctta cgacctggtg       540
     cagcaggcgc gggccgacat gcggattatc ctgcaccatt tcgagcaggc caacgatctg       600
     caaccggcat ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page