(data stored in ACNUC9435 zone)

EMBL: CP002400.PE169

CP002400.PE169       Location/Qualifiers
FT   CDS_pept        complement(181859..182818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0173"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: eel:EUBELI_01673 hypothetical protein;
FT                   TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25760"
FT                   /db_xref="GOA:E6U6M7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6M7"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADU25760.1"
FT                   /translation="MFIGNVEIKGHTALAPMAGVADTAFRTVCKAHGAAYVVGEMASAK
FT                   GFVMQATKTAELLGVTDAERPMAIQLFGSEPDVMAEAARRALAFSPDIIDINMGCPAPK
FT                   VAGNGGGSALLKDPALAGRIVRAVANAVPVPVTVKIRKGWDAAHVNAVEIARIAEENGA
FT                   AAVAVHGRTRAQQYAPPADWDIIAAVRRAVRIPVIGNGDVDSPQAAAHMLAQTGCDLVM
FT                   IGRAALGRPWLFGQVETYLRTGELLPEPNPARRMAVLLDHVRLLCALKGEHIGMREARK
FT                   HAAWYMKGLHGAALLRGEANKLDTFADLERLAAAAAKE"
     ttgttcatag gaaatgtgga gatcaaagga cacacggcgc tggccccgat ggccggcgtg        60
     gccgacacgg cgttccgcac cgtctgcaag gcgcacggcg cggcgtatgt agtaggggaa       120
     atggccagcg ccaaagggtt cgtcatgcag gcgaccaaaa cggcggagct gctcggcgtg       180
     accgatgcgg agcggccgat ggccatccag ctcttcggca gcgaaccgga cgtgatggca       240
     gaagccgcac gccgggcgct ggcgttttcc ccggatatca ttgacatcaa tatgggatgc       300
     cccgccccca aggtggcggg caacggcggc ggcagcgccc ttctcaagga ccccgcgctg       360
     gccgggcgta tcgtccgcgc cgtggcaaac gccgtgcccg tgcccgttac ggtaaaaatc       420
     cgcaaaggat gggacgcggc gcacgtcaac gccgtggaga tcgcgcgcat cgcggaggag       480
     aacggtgcgg cggctgtcgc cgtgcatggc cgtacccgtg cccagcagta tgcgcccccg       540
     gcggactggg acattatcgc cgcggtacga cgggccgtgc gcatcccggt tatcggcaac       600
     ggtgatgtgg actccccgca ggcggcggcg cacatgctcg cgcagaccgg ctgcgacctg       660
     gtaatgatcg gccgggcggc gctgggcagg ccctggctgt tcgggcaagt ggaaacttat       720
     ctgcgcaccg gcgagctgct gcccgaacca aaccccgccc gacgcatggc ggtgctgctc       780
     gaccatgtgc ggctgctctg cgccctcaag ggcgagcata tcggcatgcg ggaggcgcgt       840
     aagcacgcgg cttggtatat gaaaggcctt cacggcgcgg cgctgctgcg cggggaggcc       900
     aataagctgg acacgtttgc cgatctggag cgcctggcgg cagccgctgc caaggagtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page