(data stored in ACNUC9435 zone)

EMBL: CP002400.PE173

CP002400.PE173       Location/Qualifiers
FT   CDS_pept        complement(187246..187686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0177"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CA_C3323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25764"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N1"
FT                   /inference="similar to AA sequence:KEGG:CA_C3323"
FT                   /protein_id="ADU25764.1"
FT                   /translation="MRIGKMEFNKRMHLRVNWSAACVAAGLALLIGSMAAGHLDDLGGS
FT                   FLAGAGAGLLAAGVVLLVKTLHTLRDPEKQRVARIEEEDERNLLIDMRSSQWTLFVGIL
FT                   VLAVAAGVTAFFNRDMMHALSAVLLLLIAVKWISMVVLRRWG"
     atgcgcatcg gcaagatgga attcaacaaa aggatgcatc tgcgcgtaaa ctggtcggcg        60
     gcatgtgtag cggccgggct ggcgctgctg attggaagta tggcggcggg tcatctcgac       120
     gatttgggcg gcagctttct ggcgggcgcc ggcgcggggc tgctggcggc gggcgtggtc       180
     ttgctggtga agaccctgca cacgctgcgc gacccggaaa aacagcgggt ggcccgtatc       240
     gaagaggaag acgagcgaaa tcttttgatc gacatgcgat cctcccaatg gacgctgttc       300
     gttgggattt tggtattggc tgtggctgcg ggtgtgaccg cgttttttaa ccgggatatg       360
     atgcatgcgt tatctgcggt gttgctgctg ctgatcgcag tgaaatggat tagcatggtg       420
     gtgctgcggc gttggggata a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page