(data stored in ACNUC9435 zone)

EMBL: CP002400.PE181

CP002400.PE181       Location/Qualifiers
FT   CDS_pept        complement(194789..196726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0185"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="KEGG: cce:Ccel_1373 threonyl-tRNA synthetase;
FT                   TIGRFAM: threonyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Threonyl/alanyl tRNA synthetase
FT                   SAD; TGS domain-containing protein; Anticodon-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25772"
FT                   /db_xref="GOA:E6U6N9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6N9"
FT                   /inference="protein motif:TFAM:TIGR00418"
FT                   /protein_id="ADU25772.1"
FT                   /translation="MPNITLKDGSIRAVEPGATALALAKELGAGLYKAVCAARIGGKVV
FT                   DLRTQLQDGDTLELLTFDDPDGKKAFNHTASHILAQAVKRLYPEVKLTIGPAIEDGFYY
FT                   DFDSDLSFTQEELAKIEAEMKKIVKEDLPIERFTLPAPEAVKLMEEKSEPYKVELINEH
FT                   AGKGEPISFYKQGEFTELCAGPHLPDTGRVKAFKLTSSTGAYWRGDAKNKMLRRVYGTA
FT                   FPKKAELDAHITMLEEARKRDHNKLGRELGFFTTVDYIGQGLPVMLPKGSRVLQLLQRF
FT                   VEDEEEKRGYLLTKTPLLAKSDLYKISGHWDHYRDGMFVLGDEEKDDEVFALRPMTCPF
FT                   QFQVYLNKKRSYRDLPMRLGETSTLFRNEASGEMHGLIRVRQFTISEGHIACRPDQLEE
FT                   EFKGCVDLANFMLKTVGLDEDVSYRFSKWDENDRDKYIGTSEQWEEVQDRMRNILDDLG
FT                   IQYTEASGEAAFYGPKLDIQIRNVFGKEDTLITVQIDFQLAKRFEMKYTDTDGQEKYPY
FT                   VIHRTSIGCYERTLALLIEKYAGAMPTWLAPEQVRVLPISEKHEAYAQPVLEKLRAAGL
FT                   RATVDQRNEKIGYRIREAQLEKVPYMLVAGDREAEEGTVSVRARVGEGGTQTVDAFLKD
FT                   ILQEIAEKRH"
     atgccaaaca tcaccttgaa agacggcagt attcgtgccg tggagccggg cgcgacggcg        60
     ctcgcgctgg ccaaagagct gggcgcgggg ttatataagg cggtctgcgc cgcacgcata       120
     ggcggaaaag tcgtggacct gcgcacccaa ctgcaggacg gcgacacgct cgaactgctc       180
     acattcgatg acccggacgg taaaaaagcc ttcaaccaca ccgcgtcgca cattcttgcg       240
     caggccgtca agcggctcta tcccgaggta aagctgacca tcggtcccgc cattgaggac       300
     ggcttctatt acgatttcga cagcgacctc tctttcacac aggaggaact ggccaaaatc       360
     gaggccgaga tgaagaaaat cgtcaaggaa gacctgccca tcgaacgctt cactctgccc       420
     gctcccgagg ccgtcaagct gatggaggaa aaaagcgaac cgtataaagt ggagctcatc       480
     aacgagcacg ccggtaaggg cgagcccatt tccttctata aacagggcga gttcaccgag       540
     ctgtgcgccg gcccgcatct gcccgacacc gggcgtgtca aggcgttcaa gctgacctcc       600
     agcaccggcg cgtattggcg tggcgatgcc aaaaacaaga tgctgcgccg cgtatacggc       660
     acggcgtttc ccaaaaaggc cgaactggat gcccacatta ctatgctgga ggaggcccgc       720
     aagcgcgacc ataacaaact cggccgtgaa ctggggttct tcaccacggt ggattatatc       780
     gggcagggcc tgccggtgat gctgcccaag ggctcccgcg tactccagct gcttcagcgc       840
     tttgtggagg acgaggagga aaagcgcggc tacctgctca ccaaaacgcc gctgctggcc       900
     aagagcgacc tctacaaaat ttccggccat tgggaccact accgcgacgg catgttcgtg       960
     ctgggcgatg aggaaaagga cgacgaggtg ttcgccctgc gccccatgac ctgcccgttc      1020
     cagttccagg tctacctcaa caaaaagcgc agctaccgtg atctgcccat gcgcctgggc      1080
     gagacctcca cgctgttccg caacgaagcg tccggcgaga tgcacgggct catccgcgtg      1140
     cggcagttca ccatttcgga aggccacatc gcctgccgcc ccgaccagtt ggaggaagaa      1200
     ttcaaaggct gcgtcgatct ggcgaatttc atgctcaaaa cggtcgggct ggacgaggat      1260
     gtgtcctacc gcttctccaa atgggatgag aacgaccgcg acaaatatat cggcaccagc      1320
     gaacagtggg aagaagtaca ggaccgcatg cgcaacatcc tggacgacct cggcatccaa      1380
     tacaccgagg cgtcgggcga ggcggcgttc tacggaccca agcttgacat ccagatccgt      1440
     aatgtattcg gtaaggaaga caccctcatc accgtgcaga tcgacttcca gctggccaaa      1500
     cgctttgaaa tgaaatatac cgacacggac gggcaggaga aatatcccta tgttatccac      1560
     cgcacgtcca tcggctgcta tgaacgcacc ctggctctgc tcatcgaaaa atacgccggc      1620
     gcaatgccca cctggctggc ccccgagcag gtgcgtgtgc tgcccatctc cgagaagcac      1680
     gaggcgtatg cccaacccgt gctggaaaaa ctccgcgccg ccggcctgcg cgccaccgtg      1740
     gaccagcgca acgagaagat cggctaccgc atccgcgagg cacagctcga aaaagtgccc      1800
     tatatgctgg tggcgggcga ccgcgaggcc gaagagggca cggtgtcggt gcgcgcgcgc      1860
     gtaggcgagg gcggcaccca gaccgtggat gcctttttga aggatatcct gcaggaaatc      1920
     gccgaaaaac ggcattga                                                    1938
//

If you have problems or comments...

PBIL Back to PBIL home page