(data stored in ACNUC9435 zone)

EMBL: CP002400.PE189

CP002400.PE189       Location/Qualifiers
FT   CDS_pept        203739..204908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0193"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /note="KEGG: cpy:Cphy_0104 phosphoribosylpyrophosphate
FT                   synthetase; TIGRFAM: ribose-phosphate pyrophosphokinase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25780"
FT                   /db_xref="GOA:E6U6P7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6P7"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADU25780.1"
FT                   /translation="MSGEELKMPMPVGELGIVGMNGCEDTAMAVNDWLTHWRGSRNEHG
FT                   FKIEVECPRFGTGEGKSIIRQSVRGHDLFIITDMFNYGITYDMYGMQVPMSPDDHFQDL
FT                   TRIIAAAGGKARRINVIMPMLYEGRQHRRTSRESLDCAVMLQQLQRLGVENIITFDAHD
FT                   PRVQNAIPLIGFENIHPTYQMLKALVREEPDIRIDRSHVAVISPDEGGLNRCIYYSSVL
FT                   ELELGMFYKRRDYTRIVGGRNPIISHEYLGGNLEGKDVIIVDDIISSGDSMLDIAEQLR
FT                   AKKVGRIFMFASFGLFCNGLKKFDEAYAAGLFDRVFTTNLVYRTEALKARPWYAEVDMS
FT                   KYIALVIDTLNFDRSMSELLNPVGRIHRLMARLEQSHQAADKKAAKSLA"
     atgagcggag aagagctcaa aatgcccatg ccggtggggg aactcggcat cgtcggcatg        60
     aacggctgcg aggatacggc catggcggtc aacgactggc tgacacattg gcggggcagc       120
     cgaaacgaac atggattcaa gatcgaggtg gaatgcccgc gttttggcac aggcgagggg       180
     aaaagcatca tccggcagtc ggtgcgcggg cacgatctgt tcatcatcac cgatatgttc       240
     aactacggca tcacctacga catgtacggc atgcaggtgc ccatgagccc ggacgatcac       300
     ttccaggacc tcacccgcat cattgcggcg gcgggcggca aagcccggcg cattaacgtc       360
     attatgccca tgctgtatga gggccgccag catcgccgta cctctcgcga atcgctcgac       420
     tgcgcggtga tgctccagca gcttcagcgg ctgggggtgg aaaacatcat cacgtttgac       480
     gcgcacgacc cgcgcgtgca gaacgccatc ccgctcatcg ggtttgaaaa cattcatccc       540
     acctaccaga tgctcaaggc gctggtacgc gaggagccgg atatccgtat cgaccgctcg       600
     cacgtggcgg tcatttcgcc ggacgagggc ggcctcaacc gctgcatcta ctattcgtcc       660
     gtgctggagc ttgagctggg catgttctac aaacgtcggg actatacacg catcgtgggt       720
     gggcgcaacc ccatcatcag ccatgagtat ctcggcggca acctggaggg aaaagacgtc       780
     atcatcgtgg acgacatcat ttcctccggc gactccatgc tcgacatcgc cgagcagctg       840
     cgcgccaaaa aagtgggccg catctttatg tttgccagct tcggcctgtt ttgcaacggc       900
     ctgaagaaat ttgacgaagc ctatgcggcc ggcctgttcg accgtgtctt caccaccaat       960
     ctcgtctacc gtaccgaagc gctcaaggcg cgcccgtggt acgccgaggt ggacatgtcc      1020
     aaatacatcg cgctggtgat cgacaccctc aacttcgacc gctcaatgtc cgaactgctc      1080
     aacccggtgg gccgcatcca tcggctgatg gcccggctgg aacaatcaca ccaggcggcg      1140
     gataagaaag ctgcgaagtc gctggcttga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page