(data stored in ACNUC9435 zone)

EMBL: CP002400.PE19

CP002400.PE19        Location/Qualifiers
FT   CDS_pept        21509..22432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0019"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="KEGG: cce:Ccel_0618 dihydroorotate dehydrogenase
FT                   family protein; TIGRFAM: dihydroorotate dehydrogenase
FT                   family protein; PFAM: dihydroorotate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25610"
FT                   /db_xref="GOA:E6U5E3"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E3"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ADU25610.1"
FT                   /translation="MDKQSSALAVTVAGVTFRNPVIAASGTFGFGREYAKVFDLSGLGG
FT                   IALKGMTLKSRSGNPSPRVAETPSGMLNCIGLQNPGVEYFLKNELPFLQKQGTRLISNI
FT                   AGDAPEDYAALAARLDGEPVDMLELNISCPNVKTGGMAFGVTCEGAAEVTRAVRAATKK
FT                   PLCVKLSPNVTDIASIAQAVEDAGADALSLINTLLGMRIDIRTRRPILSNNVGGLSGPA
FT                   VFPVALRCVWQVAKAVRIPVIGMGGIATWEDAVQMFLAGASAVQVGTATFTDPYAMLAI
FT                   RDGLADYLETEHIAHISELTGQIRPN"
     atggacaagc agagttccgc cctcgccgtc acggtggcgg gcgtgacttt ccgcaacccg        60
     gtgatcgcgg ccagcggcac gtttggcttc gggcgcgaat acgccaaggt gttcgacctg       120
     tccggtctcg gcggcatcgc cctcaagggc atgacattaa aatcccggtc cggcaacccg       180
     tcgccccgcg tggcggagac gccttcgggc atgctcaact gcatcggctt gcagaacccg       240
     ggcgtggagt attttctgaa aaacgaactg ccgtttttgc agaagcaggg caccaggctg       300
     atttccaaca tcgcaggcga cgcgccggag gactacgcgg cgctggccgc ccggctggac       360
     ggcgagccgg ttgacatgct cgaactgaat atctcctgcc cgaacgtgaa aaccggcggc       420
     atggcgttcg gcgttacctg tgagggtgcg gcggaggtta cgcgcgcggt gcgcgccgcc       480
     accaaaaaac cgctttgtgt caagctttca cccaatgtga ccgacatcgc ctccattgcg       540
     caggcggtgg aggacgcggg cgcggacgcg ctttcgctca tcaacaccct gcttggcatg       600
     cgcatcgaca ttcgcacccg ccgccccatt ctttccaaca acgtgggcgg gctgtccggt       660
     ccggcggtgt tcccggtggc gctgcgctgc gtctggcagg tggccaaggc ggtgcggatt       720
     cccgtcatcg gcatgggcgg catcgccacc tgggaggacg ccgtgcagat gttccttgca       780
     ggcgcatccg ccgtccaggt gggcaccgcc accttcaccg acccttatgc catgctggcc       840
     attcgcgacg ggctggcgga ttatctggaa acggagcata tcgcgcacat ctctgagctg       900
     accgggcaga ttcgcccgaa ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page