(data stored in ACNUC9435 zone)

EMBL: CP002400.PE195

CP002400.PE195       Location/Qualifiers
FT   CDS_pept        complement(210455..211159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0199"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: ate:Athe_1027 transcriptional regulator, XRE
FT                   family; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25786"
FT                   /db_xref="GOA:E6U6Q3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q3"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADU25786.1"
FT                   /translation="MNKDFPRILTLLRKEKGISQKNAAEELGISQALLSHYEKGIRECG
FT                   LEFVVRAAGYYNVSCDYLLGRSPDRNGTMLSVEDLPEPDAAGKENVFKGSLLPTLNKKL
FT                   IENSINIIYDLLQHAGSRDLTVEVSNYLSFAVYKVFRSLYHANEKNPSGLFSVPKEQYG
FT                   ALSSASMVLTEMRLRGALLGKELPGGAAPFKDKEKLALSPEKIAQDYPLFATSLTNLVK
FT                   NAESTMEKHLRP"
     atgaacaaag actttccgcg cattctcaca ttgctgcgca aggaaaaagg catcagccaa        60
     aaaaacgctg cggaggaatt gggaatttcc caggctttgc tttcacatta tgaaaagggc       120
     atccgggaat gcgggctgga attcgtggtg cgggcggcag gctattacaa cgtctcctgt       180
     gattatctgc tcgggcgttc gcccgaccgg aacggcacga tgctttcggt ggaagacctg       240
     ccagagccgg atgccgcggg taaggaaaac gtgttcaaag ggagcctgct ccccacactg       300
     aacaaaaagc tcattgagaa ctcgatcaac atcatctacg atctgctcca gcacgcgggc       360
     agccgcgatc tgacggtgga ggtgtccaac tatctgtcct ttgcagtgta taaagtgttc       420
     cgcagcctgt atcacgccaa cgagaagaac ccgagcggcc tgttttccgt gccgaaagaa       480
     caatatgggg cgctttcttc cgcatccatg gtcctgaccg agatgcggct gcgcggcgcg       540
     ctgctgggca aggaattgcc gggaggcgcg gccccgttca aagacaagga aaaactggcg       600
     ctcagcccgg agaaaatcgc acaggattat cctctctttg ccacctcgct gaccaatctg       660
     gtaaaaaatg cagaaagcac catggaaaaa catctgcgcc catga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page